6 inventos, patentes y modelos de SAINT-REMY, JEAN-MARIE

  1. 1.-

    Eliminación de respuestas inmunitarias contra vectores virales

    (06/2015)

    Un péptido inmunogénico aislado que comprende (i) un epítopo de célula T limitado al CMH de clase II de una proteína de un vector viral y (ii) un motivo de óxido-reducción C-(X)2-[CST] o [CST]-(X)2-C, en el que dicho motivo de óxido-reducción está directamente adyacente a dicho epítopo de célula T, o está separado de dicho epítopo de célula T mediante un conector de a lo sumo 7 aminoácidos, para su uso en la prevención o la supresión, en un receptor de terapia génica o de vacunación génica, de una respuesta inmunitaria...

  2. 2.-

    Inmunoterapia dirigida a patógenos intracelulares

    (06/2015)

    Un péptido inmunogénico que comprende (i) un epítopo de célula T derivado de un antígeno asociado a un patógeno intracelular no viral y (ii) un motivo C-(X)2-[CT] o [CT]-(X)2-C, en el que dicho motivo está adyacente a dicho epítopo de célula T o está separado de dicho epítopo de célula T por un conector, para su uso en la prevención o en el tratamiento de una infección con dicho patógeno intracelular no viral.

  3. 3.-

    Anticuerpos contra el factor VIII con glucosilación modificada en la región variable

    (07/2013)

    Un anticuerpo inhibidor modificado contra el Factor VIII (FVIII) o su fragmento de unión a antígeno, - en el que el anticuerpo inhibidor no modificado comprende como regiones CDR1, CDR2 y CDR3 de lacadena pesada variable las secuencias de aminoácidos representadas por los aminoácidos 45 a 64, 79 a 95y 128 a 145 de SEC ID NO:2, respectivamente, y comprende como regiones CDR1, CDR2 y CDR3 de lacadena ligera variable las secuencias de aminoácidos representadas por los aminoácidos 44 a 55, 71 a 77 y110 a 119 de SEC ID NO:4, respectivamente, y - en el que el anticuerpo inhibidor no modificado se produce mediante expresión en una estirpe celular delinfoblastoide...

  4. 4.-

    ANTICUERPOS ANTI-IDIOTÍPICOS QUE NEUTRALIZAN LA ACTIVIDAD INHIBIDORA DE UN ANTICUERPO INHIBIDOR DIRIGIDO CONTRA EL DOMINIO C1 DEL FACTOR VIII

    (03/2012)

    Anticuerpo monoclonal antiidiotípico dirigido contra un anticuerpo humano inhibidor del factor VIII, siendo dirigido dicho anticuerpo inhibidor contra el dominio C1 del factor VIII, en el que la región variable de cada una de sus cadenas livianas está codificada por la secuencia de ácido nucleico que codifica la región variable de la cadena liviana del anticuerpo producido por la hibridoma 18B6, depositada con el número de registro CNCM I-3559 en la Collection Nationale de Cultures de Microorganismes (CNCM), y la región variable de cada una de sus cadenas pesadas está...

  5. 5.-

    COMPUESTO Y PROCEDIMIENTO PARA LA PREVENCION Y/O EL TRATAMIENTO DE LA ALERGIA

    (08/2007)
    Ver ilustración. Solicitante/s: UCB-BIOPRODUCTS, S.A. Clasificación: C12N15/62, C07K14/725, C12N15/09, A61K45/00, A61P17/00, C07K14/11, C07K14/47, A61P11/06, A61Q19/00, A61P37/08, A23L1/305, A61K8/00, C07K14/435, A61K38/00, C07K14/34, C12N1/14, C07K14/35, C07K14/31, A61K8/72, A23C9/13, A23K1/16, A61P11/02, C07K2/00, C07K7/04, C07K14/12, A23J3/04, C07K14/44, A23L2/52, A61K39/35, A61K8/64, C07K14/37, C07K14/33, A61P11/04, A23C21/08, C07K14/38, C07K14/24.

    Compuesto para la prevención y/o el tratamiento de la alergia al ácaro de polvo que comprende: - por lo menos un determinante antigénico de alergeno del ácaro de polvo que es reconocido por una célula B o un anticuerpo secretado por una célula B de un individuo no atópico a dicho alergeno, y por lo menos un determinante antigénico de un antígeno diferente de dicho alergeno que provoca la activación de las células T; en el que dicho compuesto se selecciona de entre el grupo constituido por los péptidos que presentan las secuencias siguientes: - SEC ID Nº 1: QYIKANSKFIGITELGGHEIKKVLVPGCHGS - SEC ID Nº 3: - SEC ID Nº 4: PKYVKQNTLKLATGKKGPKYVKQNTLKLATGKKGVIIGIK - SEC ID Nº 5: QYIKANSKFIGITELGGCHGSEPCNIHRGKPF - o una secuencia nucleotídica que codifica por lo menos una de dichas secuencias de aminoácidos, - o la secuencia nucleotídica SEC ID nº 6:.

  6. 6.-

    COMPOSICIONES FARMACEUTICAS QUE CONTIENEN COMPLEJOS DE ANTIGENO-ANTICUERPO, ASI COMO LA UTILIZACION DE LAS MISMAS.

    (08/1994)
    Solicitante/s: INTERNATIONAL INSTITUTE OF CELLULAR AND MOLECULAR PATHOLOGY (ICP). Clasificación: A61K39/00.

    SE PRESENTA UN COMPUESTO FARMACEUTICO ADECUADO PARA SU ADMINISTRACIONA LOS SERES HUMANOS PARA LA PREVENCION O TRATAMIENTO DE ENFERMEDADES INMUNOLOGICAS, EL COMPUESTO INCLUYE: UN COMPLEJO INMUNE DE UN ANTIGENO Y UN ANTICUERPO PURIFICADO ESPECIFICO PARA EL MISMO, EL ANTIGENO ESTA SELECCIONADO ENTRE UN GRUPO QUE CONSTA DE LOS ANTIGENOS QUE PROVOCAN REACCIONES INMUNOLOGICAS PATOGENAS EN ENFERMEDADES AUTOINMUNES Y RECHAZO DE TRANSPLANTES, Y EL ANTIGENO Y EL ANTICUERPO ESTAN PRESENTES EN UNA PROPORCION MEDIANTE LA CUAL EL ANTICUERPO BLOQUEA ESENCIALMENTE TODOS LOS ENLACES DEL ANTIGENO; TAMBIEN SE PRESENTA UN PORTADOR O DILUYENTES FARMACOLOGICAMENTE ACEPTABLE. LA INVENCION TAMBIEN SUMINISTRA UN METODO PARA LA ADMINISTRACION DEL COMPUESTO PARA EL TRATAMIENTO DE ENFERMEDADES AUTOINMUNES Y EL TRATAMIENTO O PREVENCION DE RECHAZOS EN TRANSPLANTES.