6 inventos, patentes y modelos de SAINT-REMY, JEAN-MARIE

  1. 1.-

    Un péptido inmunogénico aislado que comprende (i) un epítopo de célula T limitado al CMH de clase II de una proteína de un vector viral y (ii) un motivo de óxido-reducción C-(X)2-[CST] o [CST]-(X)2-C, en el que dicho motivo de óxido-reducción está directamente adyacente a dicho epítopo de célula T, o está separado de dicho epítopo de célula T mediante un conector de a lo sumo 7 aminoácidos, para su uso en la prevención o la supresión, en un receptor de terapia génica o de vacunación génica, de una respuesta inmunitaria...

  2. 2.-

    Un péptido inmunogénico que comprende (i) un epítopo de célula T derivado de un antígeno asociado a un patógeno intracelular no viral y (ii) un motivo C-(X)2-[CT] o [CT]-(X)2-C, en el que dicho motivo está adyacente a dicho epítopo de célula T o está separado de dicho epítopo de célula T por un conector, para su uso en la prevención o en el tratamiento de una infección con dicho patógeno intracelular no viral.

  3. 3.-

    Un anticuerpo inhibidor modificado contra el Factor VIII (FVIII) o su fragmento de unión a antígeno, - en el que el anticuerpo inhibidor no modificado comprende como regiones CDR1, CDR2 y CDR3 de lacadena pesada variable las secuencias de aminoácidos representadas por los aminoácidos 45 a 64, 79 a 95y 128 a 145 de SEC ID NO:2, respectivamente, y comprende como regiones CDR1, CDR2 y CDR3 de lacadena ligera variable las secuencias de aminoácidos representadas por los aminoácidos 44 a 55, 71 a 77 y110 a 119 de SEC ID NO:4, respectivamente, y - en el que el anticuerpo inhibidor no modificado se produce mediante expresión en una estirpe celular delinfoblastoide...

  4. 4.-

    Anticuerpo monoclonal antiidiotípico dirigido contra un anticuerpo humano inhibidor del factor VIII, siendo dirigido dicho anticuerpo inhibidor contra el dominio C1 del factor VIII, en el que la región variable de cada una de sus cadenas livianas está codificada por la secuencia de ácido nucleico que codifica la región variable de la cadena liviana del anticuerpo producido por la hibridoma 18B6, depositada con el número de registro CNCM I-3559 en la Collection Nationale de Cultures de Microorganismes (CNCM), y la región variable de cada una de sus cadenas pesadas está...

  5. 5.-


    . Ver ilustración. Solicitante/s: UCB-BIOPRODUCTS, S.A. Clasificación: C12N15/62, C07K14/725, C12N15/09, A61K45/00, A61P17/00, C07K14/11, C07K14/47, A61P11/06, A61Q19/00, A61P37/08, A23L1/305, A61K8/00, C07K14/435, A61K38/00, C07K14/34, C12N1/14, C07K14/35, C07K14/31, A61K8/72, A23C9/13, A23K1/16, A61P11/02, C07K2/00, C07K7/04, C07K14/12, A23J3/04, C07K14/44, A23L2/52, A61K39/35, A61K8/64, C07K14/37, C07K14/33, A61P11/04, A23C21/08, C07K14/38, C07K14/24.

    Compuesto para la prevención y/o el tratamiento de la alergia al ácaro de polvo que comprende: - por lo menos un determinante antigénico de alergeno del ácaro de polvo que es reconocido por una célula B o un anticuerpo secretado por una célula B de un individuo no atópico a dicho alergeno, y por lo menos un determinante antigénico de un antígeno diferente de dicho alergeno que provoca la activación de las células T; en el que dicho compuesto se selecciona de entre el grupo constituido por los péptidos que presentan las secuencias siguientes: - SEC ID Nº 1: QYIKANSKFIGITELGGHEIKKVLVPGCHGS - SEC ID Nº 3: - SEC ID Nº 4: PKYVKQNTLKLATGKKGPKYVKQNTLKLATGKKGVIIGIK - SEC ID Nº 5: QYIKANSKFIGITELGGCHGSEPCNIHRGKPF - o una secuencia nucleotídica que codifica por lo menos una de dichas secuencias de aminoácidos, - o la secuencia nucleotídica SEC ID nº 6:.

  6. 6.-