13 inventos, patentes y modelos de PASTAN, IRA, H.

  1. 1.-

    Exotoxina A de Pseudomonas mejorada con inmunogenicidad reducida

    (05/2015)

    Una exotoxina A de Pseudomonas ("PE") aislada, en donde dicha PE tiene los restos 1-273 y 285-394 eliminados y sustituciones de alanina, glicina o serina en lugar de los restos de aminoácidos D406 y Q592 correspondientes a un resto de aminoácido de la SEC ID Nº 1.

  2. 2.-

    Deleciones en el dominio II de la exotoxina A de pseudomonas que reducen la toxicidad inespecífica

    (11/2014)

    Una exotoxinaa A de Pseudomonas (PE) aislada, mutada que comprende una secuencia de la fórmula: R1n-FCS-R2n-R3n-PE dominio III funcional, en donde: n ≥ 0 o 1 independientemente para cada uno de R1, R2 y R3; R1 ≥ 1 a 10 residuos de aminoácidos; FCS ≥ una secuencia de escisión de furina de residuos de aminoácidos, la secuencia es escindible por furina y tiene un extremo aminoácido y un extremo carboxilo, en donde la FCS: a) es representada por la fórmula P4-P3-P2-P1, en donde P4 es un residuo de aminoácido en el extremo amino, P1 es un residuo de aminoácido en el extremo carboxilo, P1 es una arginina o un residuo de lisina, y dicha secuencia es escindible en el extremo...

  3. 3.-

    Exotoxinas de pseudomonas mutadas con antigenicidad reducida

    (07/2013)

    Una exotoxina A de Pseudomonas ("PE") aislada, en que dicha PE tiene una sustitución con alanina,glicina, serina o glutamina en lugar del resto aminoacídico R513, en que el resto aminoacídico R513 se define enreferencia a la secuencia de aminoácidos de la PE nativa (SEQ ID NO:1).

  4. 4.-

    EXOTOXINAS DE PSEUDOMONAS MUTADAS CON ANTIGENICIDAD REDUCIDA

    (01/2012)

    Una exotoxina A de Pseudomonas ("PE") aislada, en que dicha PE tiene una sustitución con alanina, glicina, serina o glutamina en lugar del resto aminoacídico R432, en que el resto aminoacídico R432 se define en referencia a la secuencia de aminoácidos de la PE nativa (SEQ ID NO:1).

  5. 5.-

    PÉPTIDOS INMUNOGÉNICOS Y MÉTODOS DE USO

    (04/2011)

    Un polipéptido aislado que comprende como mucho diez aminoácidos consecutivos de la secuencia de aminoácidos expuesta como MSARVRSRSRGRGDGX1X2APDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKX3X4GDCQEMDX5EKTR SERGDGSDVKEX6X7PPNPKHX8KTKEAGDGQP (SEC ID Nº 1) y comprendiendo el polipéptido uno de (a) los aminoácidos 16 a 25 de la SEC ID Nº 1 donde el aminoácido 1 (X1) es una glutamina y el aminoácido 2 (X2) es una leucina; (b) los aminoácidos 16 a 25 de la SEC ID Nº 1 donde el aminoácido 1 (X1) es una tirosina y el aminoácido 2 (X2) es una leucina; (c) los aminoácidos 59 a 68 de la SEC ID Nº 1 donde el aminoácido 1 (X3) es una valina y el aminoácido 2 (X4) es una leucina; (d) los...

  6. 6.-

    ANTICUERPOS ANTI-CD22 E INMUNOCONGUJADOS MUTADOS

    (08/2010)

    Un anticuerpo que se une específicamente a CD22, anticuerpo que comprende: una cadena ligera variable (VL) que tiene la secuencia según se define en SEC ID N.º 2 y una cadena pesada variable (VH) que tiene la secuencia según se define en SEC ID N.º 4, con la condición de que: (i) la secuencia de aminoácidos de los residuos de las posiciones que corresponden a las posiciones 30 y 31 de la cadena VL se seleccionan entre HG, GR, RG y AR; y (ii) la secuencia de aminoácidos de los residuos de las posiciones que corresponden a las posiciones 104, 105 y 106 de la cadena VH se seleccionan entre SSY, THW, YNW, TTW y STY

  7. 7.-

    ANTICUERPOS ANTI-CD22 CON AFINIDAD AUMENTADA POR LAS CELULAS LEUCEMICAS QUE EXPRESAN CD22

    (07/2010)

    Un anticuerpo anti-CD22 con una cadena ligera variable (VL) que tiene la secuencia de la cadena VL del anticuerpo RFB4 de la Figura 1 y una cadena pesada variable (VH) que tiene la secuencia de la cadena VH del anticuerpo RFB4 de la Figura 1, siempre que los restos SSY de las posiciones 104, 105 y 106 de CDR3 de la cadena VH de dicho anticuerpo anti-CD22 sean remplazados por una secuencia de aminoácidos seleccionada del grupo que consiste en THW, YNW, TTW y STY

  8. 8.-

    ANTICUERPOS, QUE INCLUYEN MOLECULAS FV, E INMUNOCONJUGADOS QUE PRESENTAN UNA AFINIDAD DE ENLACE ELEVADA PARA LA MESOTELINA Y METODOS PARA SU UTILIZACION.

    (06/2006)
    Ver ilustración. Solicitante/s: THE GOVERNMENT OF THE UNITED STATES OF AMERICA, AS REPRESENTED BY THE DEPARTMENT OF HEALTH AND HUMAN. Clasificación: G01N33/58, C12N15/13, C12N5/10, A61K39/395, G01N33/574, A61K47/48, C12N15/10, C07K16/30, G01N33/563, C12N1/11.

    Anticuerpo que comprende una cadena pesada variable (VH) y una cadena ligera variable (VL), cuyas cadenas VH y VL presentan regiones determinantes de complementariedad (CDRs) según se indica en la Figura 1 (SEC ID nº: 5).

  9. 9.-

    PEGILACION DE LIGANDOS QUE MEJORA LA ACTIVIDAD ANTITUMORAL Y REDUCE LA TOXICIDAD DE INMUNOCONJUGADOS.

    (04/2005)
    Ver ilustración. Solicitante/s: THE GOVERNMENT OF THE UNITED STATES OF AMERICA, AS REPRESENTED BY THE DEPARTMENT OF HEALTH AND HUMAN. Clasificación: A61P35/00, A61K47/48.

    Una composición que comprende una molécula dirigible unida a una molécula efectora a través de una molécula conectora y una o más moléculas de polietilenglicol (PEG) conjugadas a dicha molécula conectora.

  10. 10.-

    FRAGMENTOS POLIPEPTIDICOS RECOMBINANTES ESTABILIZADOS CON ENLACES DISULFURO, QUE TIENEN ESPECIFICIDAD DE UNION.

    (02/1999)
    Solicitante/s: THE GOVERNMENT OF THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY OF THE DEPARTMENT OF. Clasificación: C07K14/705, C07K16/00, A61K47/48.

    LA PRESENTE INVENCION SE REFIERE A MOLECULAS DE POLIPEPTIDOS RECOMBINANTES DISULFURO ESTABILIZADOS, QUE TIENEN LA HABILIDAD AGLOMERANTE Y ESPECIFICIDAD PARA OTRO PEPTIDO, TAL COMO LA REGION VARIABLE DE UNA MOLECULA DE ANTICUERPO. LOS METODOS PARA PRODUCIR ESTAS MOLECULAS Y LAS SECUENCIAS DE ACIDOS NUECLEICOS QUE CONTIENEN LAS MISMAS. EN PARTICULAR, LA INVENCION EXPONE LOS FRAGMENTOS DE ANTICUERPO FV ESTABILIZADOS POR UNA UNION DE DISULFURO QUE CONECTA LAS REGIONES V{SUB,H} Y EL V{SUB,L} DEL FRAGMENTO FV. LAS CADENAS {AL} Y {BE} DE LOS RECEPTORES DE CELULAS T PUEDEN ESTABILIZARSE SIMILARMENTE MEDIANTE LA OPERACION DESCRITA EN LA INVENCION.

  11. 11.-

    ANTICUERPO MONOCLONAL.

    (12/1998)
    Solicitante/s: THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY UNITED STATES DEPARTMENT OF COMMERCE. Clasificación: C12P21/08, A61K47/48, A61K51/00, C12N5/20.

    LA INVENCION DESCRIBE UN ANTICUERPO MONOCLONAL, MENCIONADO COMO K1 Y LOS USOS DE EL. EN PARTICULAR EL ANTICUERPO MONOCLONAL K1 PUEDE SER EMPLEADO COMO UN AGENTE PRETENDIDO TERAPEUTICO EN EL TRATAMIENTO Y DIAGNOSTICO DE VARIAS FORMAS DE CANCER.

  12. 12.-

    ANTICUERPOS MONOCLONALES DE RATON.

    (05/1998)
    Solicitante/s: THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY UNITED STATES DEPARTMENT OF COMMERCE. Clasificación: G01N33/574, G01N33/577, C12P21/08, A61K47/48, C12N5/12.

    LA PRESENTE INVENCION SE REFIERE A ANTICUERPOS MONOCLONALES Y A LOS USOS DE LOS MISMOS. EN PARTICULAR, LA INVENCION SE REFIERE A TRES ANTICUERPOS MONOCLONALES, DENOMINADOS B1, B3 Y B5, QUE SON UTILES PARA EL TRATAMIENTO Y DIAGNOSTICO DE MUCHOS TIPOS DE CANCER.

  13. 13.-

    PROTEINA RECOMBINANTE DE FUSION TOXINA ANTICUERPO.

    (11/1996)
    Solicitante/s: THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY UNITED STATES DEPARTMENT OF COMMERCE PROTEIN DESIGN LABS, INC. Clasificación: C07K14/00, C12N15/62, C12N5/10, A61K39/395, C07H21/04, C12N1/21.

    LA INVENCION DESCRIBE PROTEINAS DE FUSION ANTICUERPO-TOXINA RECOMBINANTES QUE MATAN DE MANERA SELECTIVA CELULAS QUE LLEVAN ANTIGENOS O RECEPTORES APROPIADOS. SE DESCRIBEN LA CONSTRUCCION Y EXPRESION DE UNA PROTEINA DE FUSION ANTICUERPO-TOXINA DE CADENA SENCILLA, ANTI-TAC(FV)-PE40, GEN Y CON ESTO LA PRODUCCION DE TOXINAS MEJORADAS UTILIZANDO PE.