15 inventos, patentes y modelos de LO, KIN, MING

  1. 1.-

    Un anticuerpo híbrido anti- integrina αv recombinante modificado genéticamente, que comprende (i) las regiones CDR de la cadena liviana: CDR1 : RASQDISNYLA CDR2: YTSKIHS CDR3: QQGNTFPYT (ii) las regiones CDR de la cadena pesada: CDR1: SFWMH, CDR2: YINPRSGYTEYNEIFRD, CDR3: FLGRGAMDY; (iii) las regiones armazón de la cadena liviana: FR-1: DIQMTQSPSSLSASVGDRVTITC, FR-2: WYQQKPGKAPKLLIY FR-3: GVPSRFSGSGSGTDYTFTISSLQPEDIATYYC FR-4: FGQGTKVEIK (iv) las regiones armazón de la cadena pesada FR1: QVQLQQSGAELAEPGASVKMSCKASGYTFS FR2: WVKQRPGQGLEWIG FR3: KATMTADTSSSTAYMQLSGLTSEDSAVYYCAS FR4: WGQGTSVTVSS y (v) una región constante de la...

  2. 2.-

    Tecnología de expresión para proteínas que contienen una fracción de anticuerpo de isotipo híbrido

    . Solicitante/s: MERCK PATENT GMBH. Clasificación: C07K16/46, C07K14/505, C07K16/30.

    Una proteína de fusión de inmunoglobulina de isotipo híbrido que comprende una fracción de inmunoglobulina fusionada a una fracción no inmunoglobulina; en donde la fracción no inmunoglobulina se fusiona al C-terminal de la fracción de inmunoglobulina, dicha fracción de inmunoglobulina comprende un primer dominio de un primer isotipo de anticuerpo y un segundo dominio de un segundo isotipo de anticuerpo, en donde el primer dominio de dicho primer isotipo de anticuerpo es una región de bisagra de la IgG1, y el segundo dominio de dicho segundo isotipo de anticuerpo es un dominio CH2 y CH3 de la IgG.

  3. 3.-

    Una variante de la IL-12p40 que comprende una sustitución o deleción de un aminoácido en una o más posiciones, correspondientes a las posiciones 258-266 de la IL-12 p40 humana madura parental, en donde la variante comprende sustituciones en las posiciones Lys260, Ser259 y Arg261.

  4. 7.-

    Una proteína de fusión homodimérica, que tiene actividad inhibidora de la angiogénesis, que comprende una región Fc de inmunoglobulina y una proteína diana, comprendiendo la región Fc una región bisagra, un dominio CH2 y un dominio CH3, y la proteína diana tiene la actividad inhibidora de la angiogénesis de la endostatina y es un fragmento de colágeno XVIII, y está ligada en el extremo N-terminal o en el extremo C-terminal de dicha región Fc de inmunoglobulina

  5. 8.-

    Una proteína de fusión Fc-interferón-ß con plegamiento mejorado y agregación reducida que comprende: (i) una región de Fc de inmunoglobulina; y (ii) una proteína de interferón ligada por unión de péptido o una secuencia ligadora de péptido al terminal carboxi de la región Fc de inmunoglobulina, en donde la proteína interferón comprende sustituciones de aminoácido comparado con la secuencia de interferón madura natural en las posiciones 17 y 50 y 131 y 140, o 17 y 57 y 131 y 140

  6. 9.-


    . Ver ilustración. Solicitante/s: LEXIGEN PHARMACEUTICALS CORP.. Clasificación: A61K39/00, C12N15/62, C07K14/705, G01N33/53, C07K19/00, C07K14/16, A61K39/12, A61K39/21, A61K39/39, A61P37/04, A61K39/385, A61K38/16, C07K14/52, C07K14/475, C07K14/535.

    Una composición para provocar una respuesta inmunitaria potenciada contra un antígeno peptídico o proteínico en un mamífero, comprendiendo la composición (i) una proteína de fusión que carece del dominio variable de la cadena pesada de inmunoglobulina y que comprende una región constante de cadena pesada de inmunoglobulina, enlazada mediante un enlace polipeptídico al antígeno, y (ii) una proteína de fusión que carece del dominio variable de la cadena pesada de inmunoglobulina y que comprende una región constante de cadena pesada de inmunoglobulina, enlazada mediante un enlace polipeptídico a una proteína adyuvante; en donde dichas regiones constantes de inmunoglobulina derivan de la misma especie y tienen la capacidad para unirse a un receptor de Fc.

  7. 10.-


    . Ver ilustración. Solicitante/s: LEXIGEN PHARMACEUTICALS CORP.. Clasificación: A61K48/00, C12N15/62, C12N5/10, C12N15/09, C12N15/86, C07K16/18, C07K19/00, A61P43/00, C12N15/63, C07K14/715, A61K35/76, C07K14/56, A61K38/21, A61K38/00, C12P21/02, A61P1/16, C07K14/52, A61P31/20, C12N15/863, C12N15/21.

    Una proteína de fusión que tiene una actividad biológica del interferón-alfa y que son capaces de concentrar el interferón-alfa en el hígado, dicha proteína de fusión que comprende en la dirección N a C-terminal una región Fc de inmunoglobulina que deriva del IgG1 o IgG3 y una proteína objetivo que comprende interferón-alfa.

  8. 11.-


    . Ver ilustración. Solicitante/s: MERCK PATENT GMBH. Clasificación: C12N15/62, C12N15/85, C12N5/10, C07K14/705, C07K16/28, C12N15/09, C07K16/00, C07K14/16, C07K14/71, C12P21/02, C07K14/475, C07K14/55.

    Molécula de ADN que codifica para una proteína de fusión de un dominio Fc de inmunoglobulina unida a una proteína objetivo, que tiene la bioactividad de la proteína objetivo y se secreta a partir de una célula huésped de expresión de mamífero transformada con la molécula de ADN, comprendiendo dicha molécula de ADN una secuencia de polinucleótido que codifica desde su sentido 5'' al 3'' para: #(a) una secuencia de péptido que dirige la secreción de la proteína de fusión, #(b) una región Fc de inmunoglobulina que comprende una bisagra, un dominio CH2 y un dominio CH3 de una inmunoglobulina y (c) una secuencia de proteína objetivo.

  9. 12.-


    . Solicitante/s: MERCK PATENT GMBH. Clasificación: C07K16/00, C07K16/28, C07K19/00, G01N33/68, C07K14/52, C07K14/525, C07K14/55.

    Una proteína de fusión alterada basada en anticuerpo, que tiene una vida media en circulación más larga in vivo que una proteína de fusión basada en anticuerpo correspondiente sin dicha alteración, que comprende una cadena de inmunoglobulina (Ig) o una porción de la misma con un dominio CH2 y CH3, enlazada a su término C al término N de una proteína no Ig secretada o una porción de la misma que retiene las propiedades funcionales de la proteína no Ig intacta, donde dicha alteración incluye una mutación puntual, una inserción, una eliminación o un reordenamiento de genes en el residuo de aminoácidos C-terminal de la cadena Ig.

  10. 13.-


    . Ver ilustración. Solicitante/s: LEXIGEN PHARMACEUTICALS CORP.. Clasificación: A61P35/00, C12N15/62, C12N5/10, A61K39/395, C07K19/00, A61P37/04, A61K38/20, C07K16/30, C07K14/54, C07K14/52, C07K14/55, C07K14/535.

    Una proteína de fusión multifuncional citoquina-anticuerpo que comprende una región de inmunoglobulina y una proteína de fusión de citoquina que comprende dos diferentes Citoquinas, en donde la primera citoquina es IL-12 en una forma heterodimérica o en una cadena sencilla y la segunda citoquina es IL-2 o GM-CSF, que está covalentemente enlazada al terminal amino o carboxilo de la subunidad p35 o p40 de IL-12; dicha proteína de fusión de citoquina estando fusionada al terminal amino o carboxilo de dicha región de inmunoglobulina.

  11. 14.-


    . Ver ilustración. Solicitante/s: LEXIGEN PHARMACEUTICALS CORP.. Clasificación: C07K19/00, A61K47/48, A61K38/20.

    Una proteína de fusión heterodímera que exhibe especificidad de unión para un antígeno predeterminado y actividad biológica de citoquina, que comprende una primera y una segunda cadenas químeras fusionadas por un enlace disulfuro, comprendiendo cada cadena químera una porción de cadena pesada de Ig y una primera o segunda subunidad de una citoquina heterodímera, en donde cada porción de cadena pesada de Ig de cada cadena químera está enlazada por su terminal carboxilo al terminal amino de dicha primera o segunda subunidad de la citoquina heterodímera, y en donde las subunidades son diferentes.

  12. 15.-


    . Solicitante/s: MERCK PATENT GMBH. Clasificación: A61K31/185.