36 inventos, patentes y modelos de GRANDI, GUIDO

  1. 1.-

    Péptidos antigénicos de Neisseria

    (05/2015)

    Una proteína que comprende uno o más fragmentos de la proteína "961" seleccionados de:**Fórmula** que comprende al menos un determinante antigénico, y en la que dicha proteína no es SEQ ID NO:2944 del documento WO99/57280.

  2. 2.-

    Péptidos antigénicos de Neisseria

    (04/2015)

    Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2918 del documento WO99/57280 (MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPIANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAKLKAEKFNCYQSPMEKTEVCGGDFSTTIDRTKWGMDYLV NVGMTKSVRIDIQIEAAKQ), en la que dicho(s) fragmento(s): (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de: y en la que dicha proteína no es SEC ID Nº: 2916, 2918 ó 2920 del documento WO99/57280

  3. 3.-

    Péptidos antigénicos de Neisseria

    (03/2015)

    Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2884 del documento WO99/51280 (MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTDIAGDTWNTSKVRATLLGISPATQARVKIVTYG NVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR), en la que dicho(s) fragmento(s): (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de: **Fórmula** y en la que dicha proteína no es SEC ID Nº: 2876, 2878, 2880, 2882, 2884 o 2886 del documento WO99/57280 .

  4. 4.-

    Antígenos de Neisseria meningitidis

    (03/2015)

    Una proteína que comprende una secuencia de aminoácidos antigénica con homología de secuencia del 80% o superior con SEC ID Nº 2 ó SEC ID Nº 4, con la condición de que dicha proteína no sea (i) una proteína que tiene la secuencia de aminoácidos SEC ID Nº 7, ó (ii) un fragmento de SEC ID Nº 7.

  5. 5.-

    Antígenos y composiciones de neisseria meningitidis

    (03/2015)

    Una composición que comprende una proteína aislada que comprende: (i) una secuencia de aminoácidos seleccionada del grupo consistente de las SEQ IDs 2918, 2916 y 2920; o (ii) una secuencia de aminoácidos que tiene un 90% o más de identidad de secuencia con una secuencia de aminoácidos seleccionada del grupo consistente de las SEQ IDs 2918, 2916 y 2920.

  6. 6.-

    Vacuna de estreptococo del grupo B

    (07/2014)

    Una composición inmunogénica que comprende: a. uno o más antígenos de polipéptido GBS, y b. antígenos de sacárido GBS de GBS serotipos Ia, Ib y III, donde la composición comprende GBS80 o un fragmento inmunogénica del mismo.

  7. 7.-

    Composiciones inmunógenas para Streptococcus pyogenes

    (07/2014)

    Composición inmunógena que comprende una combinación de antígenos de GAS, consistiendo dicha combinación en dos a diez antígenos de GAS, en la que dicha combinación incluye GAS40, siendo dicho "GAS40" una proteína que comprende una secuencia de aminoácidos (a) que tiene un 95% o más identidad con la SEQ ID NO: 1 y/o (b) que es un fragmento de al menos 200 aminoácidos consecutivos de la SEQ ID NO: 1 y en la que dicha combinación incluye GAS57, siendo dicho "GAS57" una proteína que comprende una secuencia de aminoácidos (a) que tiene un 95% o más identidad con la SEQ ID NO: 116 y/o (b) que es un fragmento de al menos 200 aminoácidos consecutivos de la SEQ ID NO: 116.

  8. 8.-

    Vesículas bacterianas inmunogénicas con proteínas de membrana externa

    (06/2014)

    Una bacteria de Escherichia coli patógena, que no expresa una proteína del complejo Tol-Pal y/o que tiene una mutación de bloqueo de su gen mltA

  9. 9.-

    Formas mutantes de estreptolisina O

    (08/2012)

    Una proteína de estreptolisina O (SLO) mutante purificada según SEC ID Nº: 1, en la que los aminoácidos en lasposiciones P427 y W535 están sustituidos con otro aminoácido, y en la que la actividad hemolítica de la proteínaSLO mutante se reduce al menos el 50 % con respecto a SLO natural.

  10. 10.-

    Inmunización contra Chlamydia trachomatis

    (05/2012)

    Una proteína para su uso en el tratamiento o la prevención de infección debida a Chlamydia trachomatis, en laque la proteína es (a) una proteína que comprende la secuencia de aminoácidos SEC ID 255, (b) una proteína quecomprende una secuencia de aminoácidos que tiene una identidad de secuencia del 50 % o más con la secuenciade aminoácidos de (a), o (c) una proteína que comprende un fragmento de al menos 7 aminoácidos consecutivos deSEC ID 255.

  11. 11.-

    CONFÓRMEROS DE ADHESINAS BACTERIANAS

    (12/2011)

    Una adhesina bacteriana aislada en el confórmero F, en la que la adhesina bacteriana puede generar una respuesta inmunitaria en un sujeto, en la que la adhesina bacteriana en el confórmero F no queda retenida por una columna de Q-sefarosa, y en la que la adhesina bacteriana es GBS80

  12. 12.-

    COMPOSICIONES INMUNÓGENAS PARA STREPTOCOCCUS AGALACTIAE

    (07/2011)

    Una composición que es isotónica con respecto a los seres humanos y/o está liofilizada, composición que comprende una combinación de dos o más antígenos GBS, en la que dicha combinación incluye: i) GBS 80 que comprende la secuencia de aminoácidos de SEC ID N.º 2 o un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma; y ii) al menos uno entre GBS 91 que comprende la secuencia de aminoácidos de SEC ID N.º 11, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 104 que comprende la secuencia de aminoácidos de SEC ID N.º 19, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 184 que comprende la secuencia de aminoácidos de SEC ID N.º 24, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 276 que comprende la secuencia de aminoácidos de SEC ID N.º 27, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 305 que comprende la secuencia de aminoácidos de SEC ID N.º 32, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 322 que comprende la secuencia de aminoácidos de SEC ID N.º 37, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 330 que comprende la secuencia de aminoácidos de SEC ID N.º 40, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 338 que comprende la secuencia de aminoácidos de SEC ID N.º 42, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 361 que comprende la secuencia de aminoácidos de SEC ID N.º 45, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 404 que comprende la secuencia de aminoácidos de SEC ID N.º 48, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 690 que comprende la secuencia de aminoácidos de SEC ID N.º 50, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma, GBS 691 que comprende la secuencia de aminoácidos de SEC ID N.º 53, un fragmento inmunógeno de la misma o una secuencia polipeptídica que tiene una identidad secuencial del 80% o mayor con la misma

  13. 13.-

    PROTEÍNA PORTADORA DE POLIEPÍTOPOS

    (03/2011)

    Una proteína portadora que comprende 10 a 20 epítopos CD4+ de linfocitos T

  14. 14.-

    PROTEINA RECEPTORA CD81 DE LA HEPATITIS C

    (03/2010)

    Un fragmento EC2 de la proteína CD81, que consta de los aminoácidos 113-201 de la secuencia de CD81 humano enumerado en la base de datos SWISSPROT (nº de registro P18582) o la base de datos EMBL/GENBANK (nº de registro M33680), o que tiene, al menos, una homología del 80% con los aminoácidos 113-201 de la secuencia de CD81 humana, en la que la homología se define usando el paquete de software de análisis de secuencia Pileup (Wisconsin, 1996), para usar en el tratamiento o diagnóstico de la infección por VHC

  15. 15.-

    ANTIGENOS DE NEISSERIA MENINGITIDIS

    (02/2010)

    Una proteína que comprende una secuencia de aminoácidos antigénica con homología de secuencia del 80% o superior con SEC ID Nº 2 ó SEC ID Nº 4, con la condición de que dicha proteína no sea (i) una proteína que tiene la secuencia de aminoácidos SEC ID Nº 7, ó (ii) un fragmento de SEC ID Nº 7

  16. 16.-

    ACIDOS NUCLEICOS Y PROTEINAS DE ESTREPTOCOCOS DE LOS GRUPOS A Y B

    (12/2009)
    Solicitante/s: CHIRON S.P.A. THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C07K14/315, C07K14/195.

    Una proteína que induce una inmunidad protectora contra Streptococcus agalactiae que comprende: (a) una secuencia de aminoácidos seleccionada del grupo constituido por las SEC ID 2 y 4; (b) una secuencia de aminoácidos que tiene una identidad de secuencia del 80% o superior con la SEC ID 2 ó 4; o (c) un fragmento de n o más aminoácidos consecutivos a partir de la secuencia de aminoácidos SEC ID 2 o SEC ID 4 donde n es 10, con la condición de que la proteína de (b) o (c) no sea: (i) los 246 aminoácidos C-terminales de la SEC ID 2; o (ii) un 245-mero que son los aminoácidos 336 a 580 de la SEC ID.

  17. 17.-

    SECUENCIAS GENOMICAS DE NEISSERIA Y PROCEDIMIENTOS DE USO

    (07/2009)
    Ver ilustración. Solicitante/s: CHIRON CORPORATION THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C12Q1/68, C12N15/11, C07K14/22.

    Una proteína constituida por la secuencia de aminoácidos codificada por los nucleótidos 1363680 a 1364114 de la SEC DE ID Nº: 1.

  18. 18.-

    PROTEINA NAP DE HELICOBACTER PYLORI

    (06/2009)
    Ver ilustración. Solicitante/s: CHIRON S.P.A.. Clasificación: A61K39/00, C07K16/12, C12N15/00, C07K14/205, G01N30/02.

    Un procedimiento para enriquecer la presencia de NAP de H. pylori en una mezcla de proteínas, que comprende las etapas de precipitación por saturación y cromatografía con quelado metálico, en el que la concentración final de sales de la etapa de precipitación por saturación es de una saturación de al menos el 50%.

  19. 19.-

    ANTIGENOS Y COMPOSICIONES DE NEISSERIA MENINGITIDIS

    (09/2008)
    Ver ilustración. Solicitante/s: CHIRON CORPORATION THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C12N15/31, C12Q1/68, G01N33/50, C07K16/12, A61K39/095, C07K14/22.

    Una proteína que comprende: * la secuencia de aminoácidos SEQ ID Nº: 2: * una secuencia de aminoácidos que tiene identidad de secuencia mayor del 50% con la secuencia de aminoácidos SEQ ID Nº: 2; o * un fragmento de una secuencia de aminoácidos SEQ ID Nº: 2, en el que dicho fragmento comprende 7 ó más aminoácidos consecutivos de dicha secuencia.

  20. 20.-

    PROCEDIMIENTO DE DISEÑO DE FARMACOS EN BASE A LA ESTRUCTURA PARA IDENTIFICAR COMPUESTOS QUE SE UNEN A CD81, UN RECEPTOR CELULAR DEL VIRUS DE LA HEPATITIS C.

    (04/2007)
    Solicitante/s: CHIRON SPA. Clasificación: C07K14/705, G01N33/50.

    REIVINDICACIONES 1. Un procedimiento basado en ordenador para identificar un ligando para el CD81, que comprende los pasos de: (a) proporcionar una representación estructural en 3D del bucle extracelular grande de CD81 en un medio de almacenamiento en un ordenador, en el que la representación estructural en 3D se deriva de las coordenadas atómicas cd81lel.pdb o una variante de cd811lel.pdb en el cual la des-viación R.M.S. de las coordenadas X, Y y Z de todos los átomos pesa-dos es menor que 2, 5 Amstrong, y (b) utilizar el ordenador para aplicar técnicas de diseño de fármacos basa-do en estructura a la representación estructural.

  21. 21.-

    VECTOR RECOMBINANTE PARA LA PREPARACION EXOCELULAR DE ANTICUERPOS MONOCATENARIOS EXPRESADOS EN BACILLUS SUBTILIS.

    (11/2000)
    Solicitante/s: ENITECNOLOGIE S.P.A.. Clasificación: C07K14/00, C12N15/13, C12N15/62, A61K39/395, C07K16/00, C12N15/75.

    SE DESCRIBE UN VECTOR RECOMBINANTE PARA LA EXPRESION Y SECRECION DE ANTICUERPOS EN FORMA DE MOLECULA SIMPLE (SCFV) EN B. SUBTILIS, DONDE DICHO VECTOR COMPRENDE EL PROMOTOR DEL GEN PARA PROTEASA NEUTRA, UNA NUEVA SECUENCIA DE SECRECION (I) Y UNA SECUENCIA DNA QUE CODIFICA PARA UN ANTICUERPO SCFV DE INTERES, UNA CEPA DE B. SUBTILIS TRANSFORMADA CON DICHO VECTOR RECOMBINANTE, Y UN PROCEDIMIENTO PARA LA PRODUCCION EXOCELULAR DE ANTICUERPOS SCFV POR MEDIO DE UN CULTIVO DE DICHA CEPA DE B. SUBTILIS. EL VECTOR RECOMBINANTE PERMITE LA EXPRESION DE SCFV EN UNA FORMA COMPLETAMENTE SOLUBLE Y SU SECRECION CON ELEVADO RENDIMIENTO.

  22. 22.-

    REGIONES PROMOTORAS DE LOS GENES QUE CODIFICAN LAS SUBUNIDADES PILIMICAS FIM2, FIM3 Y FIMX DE LA TOSFERINA DE BORDETELLA Y SU USO PARA LA EXPRESION DE GENES QUE CODIFICAN UNA PROTEINA DE INTERES.

    (04/1998)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/74, C12N15/31, C12N1/21, A61K39/10.

    SE DESCRIBEN EL AISLAMIENTO Y CARACTERIZACION DE LAS REGIONES PROMOTORAS DE LOS GENES QUE CODIFICAN LAS SUBUNIDADES PILIMICAS FIM2, FIM3 Y FIMX DE LA TOSFERINA DE BORDETELLA, QUE CONTIENEN ASI COMO LA CONSTRUCCION DE VECTORES QUE CONTIENEN LAS REGIONES, Y LOS MICROORGANISMOS TRANSFORMADOS POR LOS VECTORES. LAS REGIONES PROMOTORAS, O FRAGMENTOS NUCLEOTIDOS DE LAS MISMAS, SON PARTICULARMENTE UTILES PARA LA EXPRESION DE GENES REGULABRES O NO-REGULABLES QUE CODIFICAN UNA PROTEINA DE INTERES EN UNA DEFORMACION DE BORDETELLA. LAS DEFORMACIONES DE BORDETELLA TRANSFORMADAS SON PARTICULARMENTE UTILES PARA EL DESARROLLO DE UNA VACUNA ANTI-TOSFERINA EFICAZ.

  23. 23.-

    PROCESO PARA LA PRODUCCION DE D-ALFA-AMINOACIDOS

    (11/1997)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/55, C12P41/00, C12N1/21.

    SE DESCRIBE UN PROCESO PARA LA PRODUCCION DE D-ALFA-AMINOACIDOS A TRAVES DE LA CONVERSION ESTEREOESPECIFICA DE MEZCLAS RACEMICAS DE 5-SUBSTITUIDOS HIDANDOINOS, SIENDO DICHA CONVERSION LLEVADA A CABO EN PRESENCIA DE UN MICROORGANISMO TRANSFORMADO CON UN PLASMIDO CAPAZ DE MANIFESTARSE,A ALTOS NIVELES Y SIN INDUCTORES, UN SISTEMA ENZIMATICO CAPAZ DE CONVERTIR DICHOS HIDANDOINOS EN SUS CORRESPONDIENTES D-ALFA-AMINOACIDOS. TAMBIEN SE DESCRIBE UN LASMIDO QUE CONTIENE LOS GENES QUE INCLUYEN DICHO SISTEMA ENZIMATICO Y UN MICROORGANISMO SELECCIONADO DE ESCHERICHIA COLI O BACILLUS SUBTILIS TRANSFORMADOS CON DICHO PLASMIDO. LOS D-ALFA-AMINOACIDOS SON INTERMEDIARIOS UTILES EN LA PREPARACION DE SUSTANCIAS FARMACOLOGICAMENTE ACTIVAS, PESTICIDAS Y ENDULCORANTES.

  24. 24.-

    PROCESO PARA LA PREPARACION DE POLIPEPTIDOS MADUROS POR DIVISION ENZIMATICA CON FACTOR XA.

    (10/1997)
    Solicitante/s: PHARMACIA & UPJOHN AKTIEBOLAG. Clasificación: C12N15/62, C12P21/06, C07K2/00, C12N11/10.

    PROCESO PARA LA PREPARACION DE POLIPEPTIDOS MADUROS POR DIVISION ENZIMATICA CON FACTOR XA. LA PRESENTE INVENCION ESTA RELACIONADA CON LA PREPARACION DE POLIPEPTIDOS MADUROS POR HIDROLISIS ENZIMATICA DE PRECURSORES SOLUBLES CON FACTOR XA INMOVILIZADO EN UN SOPORTE DE SOLIDO INSOLUBLE. EL USO DEL ENZIMA INMOVILIZADO SIMPLIFICA EL PROCESO DE PRODUCCION DEL PRODUCTO ACABADO, MINIMIZA LA PROBABILIDAD DE QUE SE CONTAMINE EL PRODUCTO FINAL POR CAUSA DEL ENZIMA O DE LOS PRODUCTOS DE AUTOLISIS O DE OTRAS PROTEINAS DE ORIGEN ANIMAL Y POSIBILITA EL USO REPETIDO DEL MISMO SOPORTE Y UN CONTROL MEJOR DE LA HIDROLISIS DEL PRECURSOR.

  25. 25.-

    ANALOGOS DE LA HORMONA DE CRECIMIENTO HUMANA Y SU USO.

    (07/1996)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N1/21, A61K38/27, C12N15/18, C07K14/61.

    ESTA INVENCION SE REFIERE A MUTANTES DE LA HORMONA DE CRECIMIENTO HUMANA (HGH) EN QUE EL RESIDUO AMINOACIDO DE ARGININA (ARG) SE HA SUSTITUIDO EN LA POSICION 134 DE LA SECUENCIA AMINOACIDA DE LA HGH NATURAL POR UN RESIDUO AMINOACIDO ELEGIDO DEL GRUPO QUE CONSISTE EN L L ESTOS MUTANTES HAN DEMOSTRADO UNA ESTABILIDAD MEJOR HACIA LA DEGRADACION ENZIMATICA QUE LA HGH NATURAL Y UNA ACTIVIDAD BIOLOGICA INALTERADA. LOS MUTANTES SE PUEDEN UTILIZAR EN EL AMBITO TERAPEUTICO PARA EL TRATAMIENTO DE DISFUNCIONES DE LA HIPOFISIS Y EN LA CURA DE ESTADOS PATOLOGICOS TALES COMO QUEMADURAS, DISTROFIAS, PSEUDOARTROSIS Y FRACTURAS DE HUESOS.

  26. 26.-

    UN MUTANTE DE BACILLUS SUBTILES Y UN METODO PARA PRODUCIR SURFACTINA UTILIZANDO EL MUTANTE.

    (03/1996)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N1/20, C12P21/02, C07K11/02.

    LA PRESENTE INVENCION SE REFIERE A UN MUTANTE ESTABLE DE BACILLUS SUBTILIS QUE PUEDE PRODUCIR SURFACTINA CON RENDIMIENTOS ELEVADOS, UN METODO PARA PRODUCIR SURFACTINA UTILIZANDO LA CEPA Y EL USO DE LA SURFACTINA OBTENIDA PARA PROBLEMAS FARMACEUTICOS, DE ENERGIA Y AMBIENTALES.

  27. 27.-

    CEPA ESPORAGENA DE BACILLUS SUBTILIS Y SU USO COMO HUESPED PARA LA PREPARACION DE PRODUCTOS HERLOLOGOS.

    (09/1995)
    Solicitante/s: PIERREL S.P.A.. Clasificación: C12N15/75, C12N1/21, C12N15/18.

    ESTA INVENCION SE REFIERE A UNA NUEVA CEPA ESPORAGENA DE BACILLUS SUBTILIS QUE SE HA DEPOSITADO EN EL CENTRAALBUREAU VOOR SCHIMMELCULTURES BAJO EL NOMBRE CBS 432.90. ESTA CEPA, QUE MUESTRA UNA FRECUENCIA DE REVERSION PARA LA FORMACION DE ESPORAS DE MENOS DE, APROXIMADAMENTE, 10 ELEVADO -8 Y BUENA ESTABILIDAD PLASMIDA, ES APTA COMO HUESPED EN UN SISTEMA DE VECTOR HUESPED PARA LA PREPARACION DE PRODUCTOS HETEROLOGOS DE INTERES.

  28. 28.-

    UN VECTOR PLASMIDO PARA EXPRESION DE BACILOS Y USADO PARA CLONAR EL GEN ESTRUCTURAL QUE CODIFICA PARA LA HORMONA DEL CRECIMIENTO HUMANA Y UN METODO DE OBTENER LA HORMONA.

    (12/1994)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/75, C12N15/70, C12P21/02, A61K37/36.

    LA DESCRIPCION SE REFIERE A UN VECTOR PLASMIDO PARA EXPRESION EN BACILLUS Y USADO PARA CLONAR EL GEN ESTRUCTURAL QUE CODIFICA PARA LA HORMONA DEL CRECIMIENTO HUMANA, UNA MOLECULA DE ADN RECOMBINANTE QUE COMPRENDE EL VECTOR PLASMIDO Y EL GEN ESTRUCTURAL DE LA HORMONA DEL CRECIMIENTO HUMANA Y UN METODO PARA OBTENER LA HORMONA QUE CONSISTE EN INSERTAR LA MOLECULA DE ADN RECOMBINANTE EN CEPAS DE BACILLUS Y CULTIVAR LAS CEPAS TRANSFORMADAS RESULTANTES EN UN MEDIO DE CULTIVO APROPIADO, RECUPERANDO A CONTINUACION, A PARTIR DE LAS CELULAS, LA HORMONA ASI SINTETIZADA.

  29. 29.-

    UN METODO MEJORADO PARA LA PREPARACION DE HORMONA NATURAL HUMANA DE DESARROLLO EN FORMA PURA

    (12/1994)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/09, C12P21/02, C12N15/18, A61K37/36.

    SE DESCRIBE UN METODO MEJORADO PARA LA PREPARACION DE HORMONA NATURAL HUMANA DE DESARROLLO (HGH) EN FORMA PURA, LA CUAL COMPRENDE LA PREPARACION DE UN PRECURSOR DE HGH POR MEDIO DEL CULTIVO DE CELULAS DE BACILOS DELICADOS TRANSFORMADOS POR UN PLASMA HIBRIDO, LA SEPARACION DEL PRECURSOR DE LAS PROTEINAS TOTALES, LA DIGESTION DEL PRECURSOR CON EL ENCIMA FACTOR XA Y FINALMENTE LA PURIFICACION DE LA HGH NATURAL ASI OBTENIDA DE LA HIDROLISIS DE LA MEZCLA ENCIMATICA. LA HORMONA DE DESARROLLO ASI PREPARADA TIENE UNA PUREZA DEL 100% O APROXIMADAMENTE 100% Y SE USA EN PARTICULAR PARA TRATAMIENTO HUMANO.

  30. 30.-

    UN METODO PARA LA PREPARACION DE BETA INTERLEUQUINA-1 HUMANA RECOMBINADO EN FORMA HOMOGENEA

    (12/1994)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/75, C12P21/02, C12N15/25, A61K37/02.

    SE DESCRIBE UN METODO PARA LA PREPARACION DE BETA INTERLEUKIN-1 HUMANO RECOMBINADO (BETA HLL-1) EN FORMA HOMOGENEA, SIN ENDOTOXINAS Y CON UNA ACTIVIDAD ESPECIFICA DE AL MENOS 1 X 10 A LA 8 UNIDADES POR MG. MEDIANTE LA PURIFICACION, EN UN UNICO PASO CROMATOGRAFICO, DE EXTRACTO DE CELULAS SOLUBLES OBTENIDAS DE CELULAS DE BACILOS TRANSFORMADAS POR UNA MOLECULA DE DNA, COPIABLE, RECOMBINADA CON EXPRESION CONTENIENDO EL GENE, EL CUAL CODIFICA LA PROTEINA. BETA HLL-1 PURIFICADA DE ESTE MODO SE PUEDE USAR PARA SIMULAR EL SISTEMA INMUNOLOGICO DE UN PACIENTE, COMO ADYUVANTE EN UNA VACUNA, PARA LA ACTIVACION O REPARACION DE MECANISMOS EN CASO DE TEJIDOS DAÑADOS, O EN TERAPIA HUMANA PARA EL TRATAMIENTO DE DEFECTOS DE AUTO INMUNIZACION.

  31. 31.-

    La expresión y secreción de interleucina-1 beta humana, sin secuencias de aminoácidos extrañas a la molécula natural, por células de bacillus subtilis y medios y métodos para conseguirlo.

    (11/1994)
    Solicitante/s: ENIRICERCHE S.P.A.. Clasificación: C12N15/75, C12N1/21, C12N15/25.

    Un vector plasmídico con expresión en Bacillus subtilis, útil para la clonación de un gen heterólogo que codifica interleucina-1 beta humana, que incluye el gen CAT que codifica resistencia a cloranfenicol, el promotor y RBS de la proteasa neutra de Bacillus subtilis, dicho gen heterólogo que codifica interleucina-1 humana fusionado a la secuencia de la señal para la secreción de serina-proteasa de Bacillus subtilis y, corriente abajo del mismo, el sitio de restricción para EcoRI y el sitio de clonación múltiple de pUC 12.

  32. 32.-

    CLONACION DEL GEN CODIFICADOR DE LA ENZIMA ISOAMILASA Y SU USO EN LA PRODUCCION DE DICHA ENZIMA.

    (10/1994)
    Solicitante/s: ENICHEM SYNTHESIS S.P.A.. Clasificación: C12N1/20, C12N15/55, C12N9/44, C12P19/16.

    UN NUEVO FRAGMENTO DE ADN (FIGURA7) OBTENIDO A PARTIR DE BACTERIAS DEL GENERO PSEUDOMONAS Y QUE CONTIENE EL GEN PARA LA ENZIMA AMILASA. TAMBIEN CONSTITUYEN NOVEDAD LAS MOLECULAS DE ADN RECONBINANTE QUE PERMITEN LA EXPRESION EN MICROORGANISMOS HOSPEDADORES QUE CONTENGAN EL YA MENCIONADO FRAGMENTO DE ADN O REGIONES CODIFICADORAS PARA LA ISOAMILASA MADURA O PARA UN POLIPEPTIDO CON ACTIVIDAD BIOLOGICA EQUIVALENTE. TAMBIEN SON NUEVOS LOS MICROORGANISMOS TRANSFORMADOS POR LAS MENCIONADAS MOLECULAS DE ADN RECONBINANTES Y QUE SON CAPACES DE EXPRESAR Y/O LA ENZIMA ISOAMILASA MADURA O EL POLIPEPTIDO CON ACTIVIDAD BIOLOGICA EQUIVALENTE. LA ISOAMILASA RESULTANTE ES ESPECIFICA EN TECNICAS DE SECUENCIAS DE AMINOACIDOS ESTRUCTURA Y ACTIVIDAD BIOLOGICA.

1 · >>