7 inventos, patentes y modelos de BOYLE, WILLIAM, J.

  1. 2.-

    Un anticuerpo, que comprende una cadena pesada y una cadena ligera, donde: a) la cadena pesada comprende: 1) una secuencia de aminoácidos recogida en SEQ ID NO: 2; o 2) una secuencia de aminoácidos recogida en SEQ ID NO: 13; y b) la cadena ligera comprende: 1) una secuencia de aminoácidos recogida en SEQ ID NO: 4; o 2) una secuencia de aminoácidos recogida en SEQ ID NO: 14; y donde el anticuerpo se une a un ligando de osteoprotegerina (OPGL) e inhibe la unión del OPGL a un receptor de diferenciación y activación de osteoclasto (ODAR)

  2. 3.-


    . Ver ilustración. Solicitante/s: AMGEN INC.. Clasificación: A61K48/00, C12N15/12, C12N15/62, C12N5/10, C07K16/28, C12Q1/68, C07K19/00, G01N33/50, G01N33/566, C07K14/715, A61K38/17, C07K1/107, A01K67/027, C12N1/21.


  3. 4.-


    . Ver ilustración. Solicitante/s: AMGEN INC.. Clasificación: A61P35/00, C12N15/13, C12N15/85, C12N5/10, C07K16/28, A61K39/395, C07K16/46, A61K38/22, A61P19/10.

    Un anticuerpo o dominio de unión a antígeno que reconoce un epítopo DE en proteína de unión a osteoprotegerina humana (OPGbp), a) siendo el epítopo DE un epítopo que comprende una porción de la secuencia de aminoácido de la región DE de OPGbp humana desde el radical de aminoácido 212 hasta el radical de aminoácido 250 de la secuencia GFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP, y b) comprendiendo el epítopo DE la secuencia DLATE.

  4. 5.-


    . Ver ilustración. Solicitante/s: AMGEN INC.. Clasificación: C12N15/12, C12N5/10, C07K14/705, C07K16/28, A61K39/395, A61K31/70, G01N33/68, C12N15/11, G01N33/50, G01N33/577, A61K38/17, C12N1/21.

    La invención se refiere a un nuevo polipéptido, proteína de unión de osteoprotegerina, que interviene en la maduración de osteoclastos y que se ha identificado debido a su afinidad por la osteoprotegerina. Se describen también las secuencias de ácidos nucleicos que codifican el polipéptido, o fragmentos, o derivados o análogos de estos, vectores y células huésped para la producción, procedimientos de preparación de la proteína de unión de osteoprotegerina, y ensayos de fijación. La invención se refiere también a composiciones y procedimientos para el tratamiento de enfermedades óseas tales como osteoporosis, pérdida de hueso debida a artritis o metástasis, hipercalcemia, y enfermedad de Paget. Se describen también los receptores para las proteínas de unión de la osteoprotegerina. Se pueden emplear los receptores, y agonistas y antagonistas de estos para tratar enfermedades óseas.

  5. 6.-


    . Ver ilustración. Solicitante/s: COOK VASCULAR INCORPORATED. Clasificación: A61M25/00, A61M25/06.

    Un aparato introductor para uso médico, que comprende una primera y una segunda fundas introductoras , cada una de las cuales tiene una parte distal , una parte proximal y un paso que se extiende longitudinalmente a su través, estando configuradas la primera y la segunda fundas introductoras para extenderse conjuntamente dentro de un paso del cuerpo, extendiéndose la parte distal de la segunda funda introductora, al menos parcialmente, más allá de la parte distal de la primera funda introductora, caracterizado porque la primera y la segunda fundas introductoras están configuradas de manera que puedan dividirse longitudinalmente, y porque la primer funda introductora incluye una curva preformada en una parte de dicha funda que se extiende en dicho paso del cuerpo.

  6. 7.-


    . Solicitante/s: AMGEN INC.. Clasificación: C07K14/00, C12N15/12, G01N33/68, A61K38/00, G01N21/55.