6 inventos, patentes y modelos de BARBERIS, ALCIDE

  1. 1.-

    Anticuerpos que se unen al dominio extracelular del receptor Tirosina cinasa ALK

    (06/2015)

    Un anticuerpo scFv que se une a la proteína cinasa de linfoma anaplásico (ALK) humana, comprendiendo dicho anticuerpo scFv (i) una secuencia de la cadena pesada variable de SEC ID N.°: 4, y (ii) una secuencia de la cadena ligera variable de SEC ID N.°: 5, uniéndose dicho anticuerpo a un epítopo peptídico de ALK de 16 aminoácidos de SEC ID N.°: 1 con una afinidad Kd de 10 nM o menor y en donde el anticuerpo no se une a la proteína ALK de ratón.

  2. 2.-

    Regiones de marco de inmunoglobulina que demuestran estabilidad potenciada en el entorno intracelular y métodos de identificación de las mismas

    (04/2015)

    Región de marco de fragmento variable de cadena sencilla (fragmento scFv) que tiene la estructura general: NH2-VL-enlazador-VH-COOH; o NH2-VH-enlazador-VL-COOH, caracterizada porque el dominio VL tiene la secuencia de región de marco de Seq. Id. No. 1 y el dominio VH tiene la secuencia de región de marco de Seq. Id. No. 11, en la que la región de marco de scFv es estable en condiciones reductoras.

  3. 3.-

    Anticuerpos estables y solubles que inhiben TNFalfa

    (09/2013)

    Un anticuerpo o derivado de anticuerpo estable y soluble que se une específicamente a TNFa,comprendiendo dicho anticuerpo o derivado de anticuerpo un dominio variable de cadena ligera (VL) deSEO ID NO: 1 que se combina con el dominio variable de cadena pesada (VH) de SEO ID NO: 2.

  4. 4.-

    Regiones de marco de inmunoglobulina que demuestran estabilidad potenciada en el entorno intracelulcar y métodos de identificación de las mismas

    (04/2013)

    Región de marco de cadena sencilla que tiene la estructura general: NH2-VL-enlazador-VH-COOH; o NH2-VH-enlazador-VL-COOH, en la que (i) la región de marco de VH tiene la secuencia de aminoácidos J (Seq. Id. No. 10) VQLVQSGAEVKKPGASVKVSCTASGYSFTGYFLHWVRQAPGQGLEWMGRINPDSGDT IYAQKFQDRVTL TRDTSIGTVYMEL TSL TSDDTA VYYCARVPRGTYLDPWDYFDYWG QGTL VTVSS; y (ii) la región de marco de VL tiene la secuencia de aminoácidos B (Seq. Id. No. 2) EIVL TQSPSSLSASVGDRVTL TCRASQGIRNELAWYQQRPGKAPKRLlYAGSILQSG VPSRFSGSGSGTEFTL TISSLQPEDVA VYYCQQYVSLPYMFGQGTKVDIKR; o una variante de las mismas que presenta una identidad del 90% o superior con la región de marco decadena sencilla a la vez que mantiene...

  5. 5.-

    INHIBIDORES DE PROTEINA KINASA

    (06/2009)

    Utilización de un compuesto de fórmula I** ver fórmula** donde R 1, R 2 y R 4 se seleccionan independientemente a partir de hidrógeno, alquil C 1-C 6 sustituido opcionalmente, cicloalquil C3-C8 sustituido opcionalmente, NR6R7, OR6, SR6, (CH)mR6R7, donde R6 y R7 se seleccionan independientemente a partir de hidrógeno, cicloalquil C3-C8 sustituido opcionalmente, aril sustituido opcionalmente, heterociclo de 5 o 6 miembros sustituido opcionalmente, (CH2)nCO(O)R8, (CH2)m R'' donde n = 0, 1, 2, 3, 4 y donde R8 es hidrógeno, alquil C 1-C 6, cicloalquil C 3-C 8 sustituido opcionalmente, aril sustituido opcionalmente y donde R'' se selecciona a partir de hidrógeno, alquil C 1-C 6 alcoxi C 1-C 8, cicloalquil...

  6. 6.-

    INTRACUERPOS CON ESQUELETO DEFINIDO QUE ES ESTABLE EN UN AMBIENTE REDUCTOR Y APLICACIONES DE LOS MISMOS.

    (03/2005)
    Ver ilustración. Solicitante/s: ESBATECH AG. Clasificación: C12N15/13, A61K39/395, C07K19/00, G01N33/577, C07K16/00, C12N15/10.

    Un método para la identificación de las redes de intracuerpos o intracuerpos donde las células huésped adecuadas son transformadas mediante una librería donde dicha librería es un producto de fusión de un intracuerpo con una proteína marcadora donde dicha proteína marcadora es solamente activa como parte de una proteína de fusión codificando una parte soluble y estable de un intracuerpo, entonces cultivando las mencionadas células bajo condiciones que permitan la identificación y la selección de aquellas células que expresen una red soluble y estable de intracuerpo por medio de la detección de la proteína marcadora.