11 patentes, modelos y diseños de DOMANTIS LIMITED

  1. 1.-

    Un dominio variable único de inmunoglobulina anti-receptor TNFα tipo 1 que comprende la siguiente secuencia de aminoácidos: EVQLLESGGGLVQPGGSLRLSCAASGFTFAHETMVWVRQAPGKGLEWV SHIPPDGQDPFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCAL LPKRGPWFDYWGQGTLVTVSS

  2. 2.-

    Un antagonista del factor de necrosis tumoral (TNFR1) que se une al TNFR1 e inhibe la transducción de señal a través de TNFR1; (i) en el que dicho antagonista no innhibe la unión de TNFα to TNFR1; (ii) en el que dicho antagonista es un anticuepro de dominio (dAb); y (iii) en el que dicho dAb comprende una secuencia de aminoácidos que es al menos un 90% homóloga a la secuencia de aminoácidos de TAR2h-205 (SEC ID N º 627 en la Figura 271).

  3. 3.-

    Uso de un polipéptido de anticuerpo que comprende un polipéptido de dominio variable sencillo de anticuerpo enla preparación de un medicamento para el tratamiento o la prevención de un síntoma de enfermedadautoinmunitaria, en el que dicho polipéptido de dominio variable sencillo es monovalente para unión con CD40L(gp39) y antagoniza una actividad de CD40 o CD40L o de ambos, y en el que dicho polipéptido de anticuerpo inhibela unión de un dominio variable sencillo de anticuerpo que comprende la secuencia de aminoácidos de la SEC ID Nº:26 con CD40L.

  4. 4.-

    Un bacteriófago que comprende una molécula polinucleotídica que comprenden un promotor unido operablemente a una secuencia de ácido nucleico que codifica, en unión operable: una secuencia señal de secreción GAS1, un polipéptido de dominio variable de inmunoglobulina y una proteína de la cubierta de bacteriófago

  5. 5.-

    Un ligando de doble especificidad que comprende un dominio variable único de cadena pesada de inmunoglobulina que tiene una especificidad de unión a un primer antígeno o epítopo y un dominio variable único de cadena ligera de inmunoglobulina complementaria que tiene una especificidad de unión a un segundo antígeno o epítopo, en el que dichos dominios no comparten la misma especificidad, y en el que los dominios variables unen sus respectivos antígenos o epítopos simultáneamente

  6. 6.-

    Un procedimiento para sintetizar un dominio sencillo-grupo efector (dAb-grupo efector) adecuado para uso in vivo, que comprende las etapas de: (a) seleccionar un dominio variable sencillo de anticuerpo que tiene una especificidad de unión a epítope; y (b) unir el dominio sencillo de la etapa (a) a una o más regiones constantes de anticuerpo y/o una región de bisagra (un grupo efector), n el que el domino variable sencillo de anticuerpo es un dominio variable de cadena ligera

  7. 7.-


    . Ver ilustración. Inventor/es: Clasificación: A61K47/48, C07K16/24.

    Un polipéptido unido con PEG que comprende uno o dos dominios variables únicos de anticuerpo, en el que el polipéptido tiene un tamaño hidrodinámico de al menos 200 kDa y un tamaño total de PEG de 20 a 60 kDa, en el que el tamaño hidrodinámico se determina usando una columna de cromatografía sobre gel Superose 6 HR o 12 HR, una concentración de polipéptido de 1,5 mg/ml, y una velocidad de flujo de 0,5 ml/min; y en el que cada dominio variable comprende una región marco y tiene un sitio de fijación de antígeno, y cada dominio variable fija el antígeno como un dominio variable único de anticuerpo en el polipéptido y, adicionalmente, en el que dicho PEG se encuentra presente como una o múltiples moléculas unidas al polipéptido a través de un residuo aminoácido en las regiones marco de dichos uno o dos dominios variables únicos de anticuerpo.

  8. 8.-


    . Ver ilustración. Inventor/es: Clasificación: C07K14/705, C07K16/00, C12N15/10, G01N33/48, C07K1/04.

    Un procedimiento para seleccionar, de un repertorio de polipéptidos, una población de polipéptidos funcionales que se unen a un ligando diana en un primer sitio de unión y a un ligando genérico en un segundo sitio de unión, ligando genérico que puede unirse a miembros funcionales del repertorio independientemente de la especificidad del ligando diana, que comprende las etapas de: a) poner en contacto el repertorio con el ligando genérico y seleccionar los polipéptidos funcionales unidos al mismo; y b) poner en contacto los polipéptidos funcionales seleccionados con el ligando diana y seleccionar una población de polipéptidos que se unen al ligando diana; en el que los polipéptidos del repertorio son de la superfamilia de inmunoglobulinas.

  9. 9.-

    Un procedimiento para seleccionar un repertorio de polipéptidos para identificar uno o más de sus miembros que interaccionen con una o más moléculas diana, que comprende: a) inmovilizar la(s) molécula(s) diana sobre un soporte; b) formar una matriz con una pluralidad de moléculas de ácido nucleico que codifican el repertorio de polipéptidos; c) yuxtaponer la(s) molécula(s) diana y las moléculas de ácido nucleico en matriz; d) expresar las moléculas de ácido nucleico en matriz para producir los polipéptidos, de forma que dichos polipéptidos se ponen en contacto con la(s) molécula(s)...

  10. 10.-

    Un procedimiento para rastrear un primer repertorio de miembros que comprenden polipéptidos frente a un segundo repertorio de miembros que comprenden polipéptidos para identificar aquellos miembros del primer repertorio los cuales interaccionan con miembros del segundo repertorio, que comprende: (a) disponer el primer repertorio en al menos una primera serie de líneas continuas en las que cada línea de dicha primera serie comprende un miembro de dicho primer repertorio y disponer el segundo repertorio en al menos una segunda serie de líneas continuas en las que cada línea de dicha segunda serie comprende un miembro de dicho segundo repertorio, en los que los repertorios primero y segundo forman al...

  11. 11.-


    . Ver ilustración. Inventor/es: Clasificación: C07K16/24.

    Ligando doble-específico que comprende un primer dominio variable simple de inmunoglobulina con cadena pesada que presenta una especificidad de fijación a un primer epítopo o antígeno y un segundo dominio variable simple de inmunoglobulina con cadena ligera que presenta una actividad de fijación a un segundo epítopo o antígeno, en el que la fijación a uno o ambos de dichos antígenos o epítopos actúa para prolongar la vida media del ligando in vivo y en el que dichos primer y segundo dominios no son un dominio variable con cadena pesada y un dominio variable con cadena ligera que comparte la misma especificidad, con la condición de que dicho ligando doble-específico no esté constituido por un dominio VH de anti- HSA y por un dominio V de anti-â galactosidasa.