40 patentes, modelos y diseños de BIOGEN, INC.

  1. 3.-

    Compuesto que comprende la fórmula ** ver fórmula** en la que R 1 y R 2 se seleccionan independientemente del grupo que consiste en: #a) hidrógeno; #b) alquilo, alquenilo de no menos de 3 carbonos o alquinilo de no menos de 3 carbonos; en el que dicho alquilo, alquenilo o alquinilo está o bien no sustituido o bien funcionalizado con uno o más sustituyentes seleccionados del grupo que consiste en hidroxilo, alcoxilo, amino, alquilamino, dialquilamino, heterociclilo, acilamino, alquilsulfonilamino y heterociclilcarbonilamino; y #c) arilo o arilo sustituido; R 3 se selecciona del grupo que consiste en: ** ver fórmula** en el que R 3 está o bien no sustituido...

  2. 4.-


    . Ver ilustración. Inventor/es: Clasificación: A61K31/505, A61P9/00, C07D487/14.

    Un compuesto seleccionado del grupo que consiste en: (Ver tabla).

  3. 5.-


    . Ver ilustración. Inventor/es: Clasificación: A61P35/00, C07K14/00, C12N15/12, C12N5/10, C12N15/09, C07K19/00, C07K14/765, A61K47/48, A61P25/02, A61P25/00, A61P25/16, A61P3/10, A61P25/14, A61P25/04, C12N1/19, A61P9/10, A61P13/12, A61P21/00, A61K38/00, A61P25/28, C12P21/02, C12N1/21, C07K14/475, A61P29/02, C12N1/15.

    Un polipéptido que comprende una secuencia de aminoácidos al menos 90% idéntica a los aminoácidos 8-113 del Nº ID SEC: 1, en donde el polipéptido incluye un aminoácido distinto de asparagina en la posición correspondiente a la posición 95 en el Nº ID SEC: 1, en donde el aminoácido substituido en la posición correspondiente a la posición 95 introduce un sitio en el que un polialquilenglicol puede ligarse al polipéptido.

  4. 6.-


    . Ver ilustración. Inventor/es: Clasificación: A61P35/00, A61K48/00, C12N15/12, C12N15/62, C12N5/10, C07K16/28, C12N15/09, C12Q1/68, G01N33/53, C07K16/18, C07K19/00, G01N33/68, G01N33/50, C07H21/04, C07K14/715, A61K38/17, C12N15/10, A61P29/00, A61P37/02, C12N1/19, A61P13/12, A61K38/00, A61P25/28, A61P7/06, C12P21/02, C12N1/21, A61P19/02, G01N33/15, A61P35/02, C12N1/15, A61P21/04.

    Polipéptido BAFF-R (receptor de factor de activación de células B de la familia de TNF) aislado que comprende: (a) SEQ ID NO: 5; (b) un fragmento de SEQ ID NO: 5 que se une a BAFF (factor de activación de células B de la familia de TNF); (c) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 70% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; (d) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 80% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; (e) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 90% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; (f) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 95% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; o (g) SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5, modificado por una o más sustituciones de aminoácidos conservativas, en el que la secuencia modificada se une a BAFF.

  5. 7.-


    . Ver ilustración. Inventor/es: Clasificación: A61K48/00, C12N15/09, A61K47/42, C12N15/861.

    El uso de (a) un primer vector viral que comprende un ácido nucleico terapéutico que codifica un producto génico terapéutico; y (b) un agente que reduce la función de las células de Kupffer en un sujeto, en el que dicho agente es un segundo vector viral que no comprende dicho ácido nucleico terapéutico, para la preparación de una composición farmacéutica para aumentar el nivel de un producto génico terapéutico en dicho sujeto.

  6. 8.-

    Un compuesto que comprende la fórmula: en la que R1 y R2, se seleccionan independientemente del grupo constituido por: a) hidrógeno; b) alquilo, alquenilo de no menos de 3 carbonos, y alquinilo de no menos de 3 carbonos; en el que el alquilo, alquenilo, o alquinilo están sin sustituir o funcionalizados con uno o dos sustituyentes seleccionados del grupo constituido por hidroxi, alcoxi, amino, alquilamino, dialquilamino, heterociclilo, acilamino, alquilsulfonilamino, y heterociclilcarbonilamino; y c) arilo y arilo sustituido; R3 es un grupo tricíclico seleccionado del grupo constituido por: en el que el grupo tricíclico está funcionalizado con uno...

  7. 9.-


    . Inventor/es: Clasificación: A61K31/445, A61K31/40, C07D401/12, C07D401/06, C07D401/10, A61K31/4025, C07D401/08, C07D401/14, C07K5/06, C07D405/14, C07D207/16, C07D405/12, C07D403/12, C07K5/02.

    Un compuesto de fórmula: R3-L-L'-R1 en la cual R1 es pirrolidinil-SO2-fenilo opcionalmente sustituido, en el que el sustituyente opcional es alquilo o halo; L' es de fórmula (iv) en la que Y1 es -NH-CO-, R2 es H, Y2 es un enlace y X es COOH; L es de fórmula (v) en la que Y3 -(CH2)0-5-, e Y4 es -CO-NH; y R3 es de fórmula R4-Y5-N(R5)-CH(R6)-, en que R6 es la cadena lateral de leuci- na o isoleucina; R5 es hidrógeno o metilo; Y5 es C(=O)- y R4 es o-metilfenilureidofenil- CH2; o una sal farmacéuticamente aceptable del mismo.

  8. 10.-


    . Inventor/es: Clasificación: A61K31/00, A61P37/00, A61K31/551.


  9. 11.-


  10. 12.-


    . Inventor/es: Clasificación: A61K39/395, A61K38/55, A61K38/17, C07K19/00.


  11. 13.-


    . Ver ilustración. Inventor/es: Clasificación: C12N15/62, C07K19/00, C07K14/565.

    Un polipéptido que comprende: (a) un mutante de interferón-beta-1a (IFN-beta) seleccionado del grupo que consiste en mutantes de IFN-beta que tienen la secuencia de aminoácidos mostrada en la Tabla 1 como A1, B1, C1, CD1 y CD2; y (b) un dominio bisagra, CH2 y CH3 de una inmunoglobulina.

  12. 14.-


    . Inventor/es: Clasificación: A61K48/00, C12N15/12, C12N15/62, C12N5/10, C12Q1/68, C07K16/18, G01N33/50, C07K14/47, C12N1/21, C12N5/12, A61K38/16.


  13. 15.-


    . Ver ilustración. Inventor/es: Clasificación: A61P35/00, A61P43/00, A61K47/48, A61P31/12, A61K38/19.

    Una composición que comprende un interferón-beta- 1a glicosilado (IFN-â) que comprende la secuencia de aminoácidos MSYNLLGFLQRSSNFQCQKLLW QLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNE TIVENLLANVYHQINHLKTVLEEKLEKEDFTRGALMSSLHLKRYYGRILHYLKAKEYSH CAWTIVRVEILRNFYRINRLTGYLRN acoplada a un polímero que no se da en la naturaleza en un extremo N-terminal de dicho interferón-beta-1a glicosilado, y dicho polímero comprende un resto de polialquilenglicol.

  14. 16.-


    . Ver ilustración. Inventor/es: Clasificación: A61K48/00, C12N5/10, C12N15/86.

    El uso de un vector viral que comprende un gen que codifica la proteína interferón-â para la preparación de un medicamento para el tratamiento del cáncer, en el que (a) dicha proteína interferón-â se expresa a partir de dicho gen; y (b) dicho vector viral se selecciona del grupo que consiste en un vector adenoviral, un vector lentiviral, un vector baculoviral, un vector viral de Epstein Barr, un vector papovaviral, un vector viral de vaccinia y un vector viral de herpes simple.

  15. 17.-


    . Inventor/es: Clasificación: A61K39/395, A61K38/02.


  16. 18.-


    . Ver ilustración. Inventor/es: Clasificación: A61K39/395, A61P1/04, A61K38/17, A61P37/00, C12N5/06, A61P27/02, A61P19/02.

    Uso de una cantidad efectiva de un agente de unión a CD2 seleccionado del grupo de homólogos del anticuerpo de LFA-3, polipéptidos LFA-3 solubles, polipéptidos CD2 solubles, agentes miméticos de CD2, y agentes miméticos de LFA-3 para la preparación de una composición farmacéutica para la reducción selectiva de linfocitos T CD45RO-positivos efectores y de memoria en un sujeto para, por medio de lo cual, tratar una afección médica, seleccionándose la afección del grupo constituido por artritis psoriática, esclerosis múltiple, dermatitis atópica, uveitis, enfermedad inflamatoria del intestino, enfermedad de Crohn, colitis ulcerosa y linfoma cutáneo de células T.

  17. 19.-


    . Inventor/es: Clasificación: C12N15/12, C07K14/705, C07K16/28, A61K38/17, C12N1/21, C12N5/18.


  18. 20.-


    . Inventor/es: Clasificación: A61K39/395, A61P11/00, A61P37/00.

    Uso de una composición que comprende un homólogo de anticuerpo que es un antagonista de una interacción entre una integrina que lleva la subunidad alfa 4 y un ligando para una integrina que lleva la subunidad alfa 4, para la preparación de una composición farmacéutica para el tratamiento de la fibrosis en un sujeto.

  19. 21.-


    . Inventor/es: Clasificación: A61P15/00, A61K39/395, A61P17/06, G01N33/68, G01N33/577, A61K38/17, A61P37/00, A61P29/00, A61P21/00.


  20. 22.-


    . Inventor/es: Clasificación: A61K39/395, G01N33/53, A61K38/21, A61K38/19.


  21. 23.-


    . Inventor/es: Clasificación: A61P13/12, A61K31/635, A61K31/52.

    Procedimientos y composiciones para restablecer la función diurética y renal que comprenden antagonistas de adenosina A1.

  22. 24.-


    . Ver ilustración. Inventor/es: Clasificación: A61K31/40, C07D207/16.

    Un compuesto de fórmula (I): **FORMULA** o un profármaco farmacéuticamente aceptable, una sal o un isómero del mismo, en donde dicho profármaco es un profármaco de éster.

  23. 25.-


    . Inventor/es: Clasificación: C07K14/00, C07K7/04, C07K14/02.


  24. 26.-


    . Ver ilustración. Inventor/es: Clasificación: C07K1/00, C07K14/725, G01N33/68, C07K14/525.


  25. 27.-


    . Inventor/es: Clasificación: C07D213/75, A61K31/17, C07C271/22, A61K31/27, A61K31/36, C07C275/28, A61K31/16, C07D317/60, C07C237/22, C07C323/52, C07D213/55.


  26. 28.-


    . Inventor/es: Clasificación: A61K38/17.


  27. 29.-


  28. 30.-


    . Inventor/es: Clasificación: C07K14/00, C12N15/12, C12N15/62, A61K39/395, G01N33/566, A61K38/00, C12N1/21, G01N33/564.


  29. 31.-


    . Inventor/es: Clasificación: C12N15/13, C07K16/28, A61K39/395, C12P21/08.


  30. 32.-


    . Inventor/es: Clasificación: C07K14/00, C12N15/62, C12N5/10, C12N15/31, A61K39/21, C12N15/87, C12N9/02, C12N15/37, C12N15/49, C12N9/22, C12N1/11.


1 · >>