40 patentes, modelos y diseños de BIOGEN, INC.

  1. 1.-

    Tratamiento de neoplasias hematológicas asociadas con células tumorales circulantes utilizando anticuerpo quimérico dirigido contra CD20

    (04/2015)

    Utilización de un anticuerpo dirigido contra CD20 que comprende regiones constantes gamma 1 humanas en la fabricación de un medicamento para el tratamiento de la leucemia linfocítica crónica (CLL) en un paciente humano, en la que el medicamento es para la administración al paciente humano en una dosis de 500 a 1.500 mg/m2.

  2. 2.-

    METODOS DE TRATAMIENTO DE LESION ISQUEMICA O HEMORRAGICA DEL SISTEMA NERVIOSO CENTRAL USANDO ANTAGONISTAS ANTI-INTEGRINAS ALFA 4

    (03/2010)

    Uso de un anticuerpo anti-alpha4 o un fragmento de unión a alpha4 del mismo para la preparación de una composición farmacéutica para el tratamiento de lesiones de la médula espinal

  3. 3.-

    POLICICLOALQUILPURINAS COMO ANTAGONISTAS DEL RECEPTOR DE ADENOSINA

    (07/2009)

    Compuesto que comprende la fórmula ** ver fórmula** en la que R 1 y R 2 se seleccionan independientemente del grupo que consiste en: #a) hidrógeno; #b) alquilo, alquenilo de no menos de 3 carbonos o alquinilo de no menos de 3 carbonos; en el que dicho alquilo, alquenilo o alquinilo está o bien no sustituido o bien funcionalizado con uno o más sustituyentes seleccionados del grupo que consiste en hidroxilo, alcoxilo, amino, alquilamino, dialquilamino, heterociclilo, acilamino, alquilsulfonilamino y heterociclilcarbonilamino; y #c) arilo o arilo sustituido; R 3 se selecciona del grupo que consiste en: ** ver fórmula** en el que R 3 está o bien no sustituido...

  4. 4.-

    DERIVADOS DE PURINA CONDENSADOS COMO ANTAGONISTAS DE RECEPTORES DE ADENOSINA A1

    (11/2008)
    Ver ilustración. Inventor/es: LIN, KO-CHUNG, VU,CHI. Clasificación: A61K31/505, A61P9/00, C07D487/14.

    Un compuesto seleccionado del grupo que consiste en: (Ver tabla).

  5. 5.-

    CONJUGADOS POLIMEROS DE NEUBLASTINA Y METODOS PARA USAR LOS MISMOS

    (02/2008)
    Ver ilustración. Inventor/es: PEPINSKY, R., BLAKE, SAH,DINAH,W.,Y, BORJACK-SJODIN,PAULA,ANN, MILLER,STEPHAN,S, ROSSOMANDO,ANTHONY. Clasificación: A61P35/00, C07K14/00, C12N15/12, C12N5/10, C12N15/09, C07K19/00, C07K14/765, A61K47/48, A61P25/02, A61P25/00, A61P25/16, A61P3/10, A61P25/14, A61P25/04, C12N1/19, A61P9/10, A61P13/12, A61P21/00, A61K38/00, A61P25/28, C12P21/02, C12N1/21, C07K14/475, A61P29/02, C12N1/15.

    Un polipéptido que comprende una secuencia de aminoácidos al menos 90% idéntica a los aminoácidos 8-113 del Nº ID SEC: 1, en donde el polipéptido incluye un aminoácido distinto de asparagina en la posición correspondiente a la posición 95 en el Nº ID SEC: 1, en donde el aminoácido substituido en la posición correspondiente a la posición 95 introduce un sitio en el que un polialquilenglicol puede ligarse al polipéptido.

  6. 6.-

    POLIPEPTIDOS Y ACIDOS NUCLEICOS DE RECEPTOR

    (12/2007)
    Ver ilustración. Inventor/es: AMBROSE,CHRISTINE,M, THOMPSON,JEFFREY,S. Clasificación: A61P35/00, A61K48/00, C12N15/12, C12N15/62, C12N5/10, C07K16/28, C12N15/09, C12Q1/68, G01N33/53, C07K16/18, C07K19/00, G01N33/68, G01N33/50, C07H21/04, C07K14/715, A61K38/17, C12N15/10, A61P29/00, A61P37/02, C12N1/19, A61P13/12, A61K38/00, A61P25/28, A61P7/06, C12P21/02, C12N1/21, A61P19/02, G01N33/15, A61P35/02, C12N1/15, A61P21/04.

    Polipéptido BAFF-R (receptor de factor de activación de células B de la familia de TNF) aislado que comprende: (a) SEQ ID NO: 5; (b) un fragmento de SEQ ID NO: 5 que se une a BAFF (factor de activación de células B de la familia de TNF); (c) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 70% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; (d) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 80% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; (e) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 90% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; (f) una secuencia de aminoácidos que se une a BAFF y es idéntica en al menos un 95% a SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5; o (g) SEQ ID NO: 5 o un fragmento de SEQ ID NO: 5, modificado por una o más sustituciones de aminoácidos conservativas, en el que la secuencia modificada se une a BAFF.

  7. 7.-

    METODO PARA MEJORAR EL SUMINISTRO DE UN ACIDO NUCLEICO TERAPEUTICO

    (11/2007)
    Ver ilustración. Inventor/es: BARSOUM, JAMES, G., FAWELL, STEPHEN, E., PARR,MICHAEL. Clasificación: A61K48/00, C12N15/09, A61K47/42, C12N15/861.

    El uso de (a) un primer vector viral que comprende un ácido nucleico terapéutico que codifica un producto génico terapéutico; y (b) un agente que reduce la función de las células de Kupffer en un sujeto, en el que dicho agente es un segundo vector viral que no comprende dicho ácido nucleico terapéutico, para la preparación de una composición farmacéutica para aumentar el nivel de un producto génico terapéutico en dicho sujeto.

  8. 8.-

    ANTAGONISTAS DEL RECEPTOR DE ADENOSINA Y PROCEDIMIENTOS DE PREPARACION Y USO DEL MISMO

    (10/2007)

    Un compuesto que comprende la fórmula: en la que R1 y R2, se seleccionan independientemente del grupo constituido por: a) hidrógeno; b) alquilo, alquenilo de no menos de 3 carbonos, y alquinilo de no menos de 3 carbonos; en el que el alquilo, alquenilo, o alquinilo están sin sustituir o funcionalizados con uno o dos sustituyentes seleccionados del grupo constituido por hidroxi, alcoxi, amino, alquilamino, dialquilamino, heterociclilo, acilamino, alquilsulfonilamino, y heterociclilcarbonilamino; y c) arilo y arilo sustituido; R3 es un grupo tricíclico seleccionado del grupo constituido por: en el que el grupo tricíclico está funcionalizado con uno...

  9. 9.-

    INHIBIDORES DE LA ADHESION CELULAR.

    (04/2007)
    Inventor/es: LEE, WEN-CHERNG, SCOTT, DANIEL, CORNEBISE, MARK, PETTER, RUSSELL. Clasificación: A61K31/445, A61K31/40, C07D401/12, C07D401/06, C07D401/10, A61K31/4025, C07D401/08, C07D401/14, C07K5/06, C07D405/14, C07D207/16, C07D405/12, C07D403/12, C07K5/02.

    Un compuesto de fórmula: R3-L-L'-R1 en la cual R1 es pirrolidinil-SO2-fenilo opcionalmente sustituido, en el que el sustituyente opcional es alquilo o halo; L' es de fórmula (iv) en la que Y1 es -NH-CO-, R2 es H, Y2 es un enlace y X es COOH; L es de fórmula (v) en la que Y3 -(CH2)0-5-, e Y4 es -CO-NH; y R3 es de fórmula R4-Y5-N(R5)-CH(R6)-, en que R6 es la cadena lateral de leuci- na o isoleucina; R5 es hidrógeno o metilo; Y5 es C(=O)- y R4 es o-metilfenilureidofenil- CH2; o una sal farmacéuticamente aceptable del mismo.

  10. 10.-

    INHIBIDORES DE LA ADHESION CELULAR.

    (04/2007)
    Inventor/es: ZHENG, ZHONGLI, ENSINGER, CAROL, L., ADAMS, STEVEN, P. Clasificación: A61K31/00, A61P37/00, A61K31/551.

    LA PRESENTE INVENCION SE REFIERE A NUEVOS COMPUESTOS QUE SON UTILES PARA LA INHIBICION Y PREVENCION DE LA ADHESION CELULAR Y DE PATOLOGIAS MEDIADAS POR DICHA ADHESION. ESTA INVENCION SE REFIERE IGUALMENTE A FORMULACIONES FARMACEUTICAS QUE COMPRENDEN TALES COMPUESTOS, Y A LOS PROCEDIMIENTOS DE USO DE LOS MISMOS PARA LA INHIBICION Y PREVENCION DE LA ADHESION CELULAR Y DE LAS PATOLOGIAS MEDIADAS POR DICHA ADHESION. LOS COMPUESTOS Y COMPOSICIONES FARMACEUTICAS DE LA PRESENTE INVENCION PUEDEN UTILIZARSE COMO AGENTES TERAPEUTICOS O PROFILACTICOS. SON PARTICULARMENTE ADECUADOS PARA EL TRATAMIENTO DE MUCHAS ENFERMEDADES INFLAMATORIAS Y AUTOINMUNES.

  11. 11.-

    LIGANDO 3 RET PARA ESTIMULAR EL CRECIMIENTO NEURAL Y RENAL.

    (04/2007)

    LA PRESENTE INVENCION SE REFIERE A SECUENCIAS DE NUCLEOTIDOS QUE CODIFICAN UN LIGANDO RET (RETL9), ASI COMO A LOS PROCEDIMIENTOS PARA ESTIMULAR EL CRECIMIENTO NEURAL Y RENAL POR TRATAMIENTO DE CELULAS Y SUJETOS MAMIFEROS CON ADN O PROTEINA DEL RETL. LA INVENCION PROPORCIONA UNA MOLECULA AISLADA Y PURIFICADA DE ADN QUE CODIFICA UN RETL, QUE TIENE LA SECUENCIA DE NUCLEOTIDOS DE CUALQUIER RETL, PERO INCLUYE ESPECIFICAMENTE EL ADNC DEL RETL1 DE LA RATA (SEQ ID NO:1), EL ADNC DEL RETL1 HUMANO PARCIAL (SEQ ID NO:8), EL ADNC DEL RETL1 HUMANO CON TODA SU LONGITUD (SEQ ID NO:10), EL ADNC DEL RETL2 HUMANO (SEQ ID NO:12), EL ADNC DEL RETL3 DE RATON (SEQ ID NO:12)...

  12. 12.-

    RECEPTORES SOLUBLES DE LINFOTOXINA B, ANTICUERPOS ANTI-RECEPTOR DE LINFOTOXINA Y ANTICUERPOS ANTI-LIGANDOS DE LINFOTOXINA COMO AGENTES TERAPEUTICOS PARA EL TRATAMIENTO DE ENFERMEDADES INMUNOLOGICAS.

    (03/2007)
    Inventor/es: BROWNING, JEFFREY, HOCHMAN, PAULA, SUSAN, RENNERT, PAUL, D., MACKAY, FABIENNE. Clasificación: A61K39/395, A61K38/55, A61K38/17, C07K19/00.

    SE PRESENTAN COMPOSICIONES Y PROCEDIMIENTOS QUE COMPRENDEN "AGENTES BLOQUEANTES DEL RECEPTOR DE LINFOTOXINA- BE ) QUE BLOQUEAN LA SEÑALIZACION DEL RECEPTOR DE LINFOTOXINA- BE Y SON UTILES PARA ALTERAR ENFERMEDADES INMUNOLOGICAS, Y PARTICULARMENTE RESPUESTAS INMUNES INTERMEDIADAS POR ANTICUERPOS.

  13. 13.-

    PROTEINAS DE FUSION CON INTERFERON-BETA Y USOS.

    (02/2007)
    Ver ilustración. Inventor/es: WHITTY, ADRIAN, RUNKEL, LAURA, BRICKELMAIER, MARGOT, HOCHMAN, PAULA. Clasificación: C12N15/62, C07K19/00, C07K14/565.

    Un polipéptido que comprende: (a) un mutante de interferón-beta-1a (IFN-beta) seleccionado del grupo que consiste en mutantes de IFN-beta que tienen la secuencia de aminoácidos mostrada en la Tabla 1 como A1, B1, C1, CD1 y CD2; y (b) un dominio bisagra, CH2 y CH3 de una inmunoglobulina.

  14. 14.-

    MODULADORES DE LA REGENERACION TISULAR.

    (09/2006)
    Inventor/es: SANICOLA-NADEL, MICHELE, CATE, RICHARD, L., BONVENTRE, JOSEPH, V., HESSION, CATHERINE, A., ICHIMURA, TAKAHARU, WEI, HENRY. Clasificación: A61K48/00, C12N15/12, C12N15/62, C12N5/10, C12Q1/68, C07K16/18, G01N33/50, C07K14/47, C12N1/21, C12N5/12, A61K38/16.

    SE EXPONEN PROTEINAS REGULADAS HACIA ARRIBA EN TEJIDOS LESIONADOS O EN REGENERACION, ASI COMO EL DNA QUE LAS CODIFICA, AL MISMO TIEMPO QUE COMPOSICIONES TERAPEUTICAS Y PROCEDIMIENTOS DE TRATAMIENTO QUE INCLUYEN ESTOS COMPUESTOS.

  15. 15.-

    CONJUGADOS DE POLIMERO E INTERFERON BETA-1A Y SUS USOS.

    (08/2006)
    Ver ilustración. Inventor/es: WHITTY, ADRIAN, RUNKEL, LAURA, BRICKELMAIER, MARGOT, HOCHMAN, PAULA, PEPINSKY, BLAKE. Clasificación: A61P35/00, A61P43/00, A61K47/48, A61P31/12, A61K38/19.

    Una composición que comprende un interferón-beta- 1a glicosilado (IFN-â) que comprende la secuencia de aminoácidos MSYNLLGFLQRSSNFQCQKLLW QLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNE TIVENLLANVYHQINHLKTVLEEKLEKEDFTRGALMSSLHLKRYYGRILHYLKAKEYSH CAWTIVRVEILRNFYRINRLTGYLRN acoplada a un polímero que no se da en la naturaleza en un extremo N-terminal de dicho interferón-beta-1a glicosilado, y dicho polímero comprende un resto de polialquilenglicol.

  16. 16.-

    METODOS Y COMPOSICIONES PARA TERAPIAS CONTRA EL CANCER UTILIZANDO GENES CODIFICANTES DE INTERFERON-BETA.

    (08/2006)
    Ver ilustración. Inventor/es: BARSOUM, JAMES, G., QIN, XIAO-QIANG. Clasificación: A61K48/00, C12N5/10, C12N15/86.

    El uso de un vector viral que comprende un gen que codifica la proteína interferón-â para la preparación de un medicamento para el tratamiento del cáncer, en el que (a) dicha proteína interferón-â se expresa a partir de dicho gen; y (b) dicho vector viral se selecciona del grupo que consiste en un vector adenoviral, un vector lentiviral, un vector baculoviral, un vector viral de Epstein Barr, un vector papovaviral, un vector viral de vaccinia y un vector viral de herpes simple.

  17. 17.-

    ANTICUERPO PARA EL TRATAMIENTO DE LA DIABETES DEPENDIENTE DE LA INSULINA.

    (06/2006)
    Inventor/es: BURKLY, LINDA, C. Clasificación: A61K39/395, A61K38/02.

    SE PRESENTA UN METODO PARA LA PREVENCION DE LA DIABETES DEPENDIENTE DE LA INSULINA (DE TIPO I). EL METODO COMPRENDE LA ADMINISTRACION DE UN ANTICUERPO, POLIPEPTIDO U OTRA MOLECULA QUE RECONOZCA EL VLA4.

  18. 18.-

    MODULACION DE CELULAS T EFECTORAS Y DE MEMORIA CON UN LIGANDO DE CD2.

    (05/2006)
    Ver ilustración. Inventor/es: MAGILAVY, DANIEL. Clasificación: A61K39/395, A61P1/04, A61K38/17, A61P37/00, C12N5/06, A61P27/02, A61P19/02.

    Uso de una cantidad efectiva de un agente de unión a CD2 seleccionado del grupo de homólogos del anticuerpo de LFA-3, polipéptidos LFA-3 solubles, polipéptidos CD2 solubles, agentes miméticos de CD2, y agentes miméticos de LFA-3 para la preparación de una composición farmacéutica para la reducción selectiva de linfocitos T CD45RO-positivos efectores y de memoria en un sujeto para, por medio de lo cual, tratar una afección médica, seleccionándose la afección del grupo constituido por artritis psoriática, esclerosis múltiple, dermatitis atópica, uveitis, enfermedad inflamatoria del intestino, enfermedad de Crohn, colitis ulcerosa y linfoma cutáneo de células T.

  19. 19.-

    MOLECULAS DE ADHESION DE LEUCOCITOS A CELULAS ENDOTELIALES (ELAMS) Y MOLECULAS INVOLUCRADAS EN LA ADHESION DE LEUCOCITOS (MILAS).

    (04/2006)
    Inventor/es: HESSION, CATHERINE, LOBB, ROY R., GOELZ, SUSAN E., OSBORN, LAURELEE, BENJAMIN, CHRISTOPHER D., ROSA, MARGARET D. Clasificación: C12N15/12, C07K14/705, C07K16/28, A61K38/17, C12N1/21, C12N5/18.

    LA INVENCION SE REFIERE A SECUENCIAS DE ADN QUE CODIFICAN LAS MOLECULAS DE ADHESION DE LEUCOCITOS DE CELULAS ENDOTELIALES ELAMS, METODOS PARA PRODUCIR TALES MOLECULAS, Y ELAM (INCLUIDO LAS MOLECULAS ESPECIFICAS ELAM1 Y VLAM1 Y 1B) ESENCIALMENTE LIBRES DE PROTEINAS ANIMALES ASOCIADAS. LA INVENCION TAMBIEN SE REFIERE A ANTICUERPOS A ELAMS, SECUENCIAS DE ADN QUE CODIFICAN MOLECULAS IMPLICADA EN LA ADHESION DE LEUCOCITOS (MILAS), UN METODO PARA PRODUCIR TALES MOLECULAS Y MILAS (INCLUIDO LA MOLECULAS ESPECIFICA, CDX) ESENIALMENTE LIBRES DE PROTEINAS ANIMALES NORMALMENTE ASOCIADAS. TAMBIEN SE REFIERE A PREPARACIONES QUE SON REACTIVAS PARA MILAS.

  20. 20.-

    METODO PARA TRATAR LA FIBROSIS UTILIZANDO UN ANTAGONISTA DE LA SUBUNIDAD ALFA 4 DE LA INTEGRINA.

    (12/2005)
    Inventor/es: LOBB, ROY R., GOTWALS, PHILIP. Clasificación: A61K39/395, A61P11/00, A61P37/00.

    Uso de una composición que comprende un homólogo de anticuerpo que es un antagonista de una interacción entre una integrina que lleva la subunidad alfa 4 y un ligando para una integrina que lleva la subunidad alfa 4, para la preparación de una composición farmacéutica para el tratamiento de la fibrosis en un sujeto.

  21. 21.-

    RECEPTORES SOLUBLES DE LA LINFOTOXINA-BETA, ANTICUERPOS CONTRA EL RECEPTOR DE LA LINFOTOXINA Y ANTICUERPOS LIGANDOS, COMO AGENTES TERAPEUTICOS PARA EL TRATAMIENTO DE ENFERMEDADES INMUNOLOGICAS.

    (03/2005)
    Inventor/es: BROWNING, JEFFREY, L., BENJAMIN, CHRISTOPHER D., HOCHMAN, PAULA, S. Clasificación: A61P15/00, A61K39/395, A61P17/06, G01N33/68, G01N33/577, A61K38/17, A61P37/00, A61P29/00, A61P21/00.

    ESTA INVENCION ESTA RELACIONADA CON COMPOSICIONES Y METODOS CONSISTENTES EN "AGENTES BLOQUEANTES DEL RECEPTOR DE LINFOTOXINA BE}", QUE BLOQUEAN LA SEÑALIZACION DEL RECEPTOR DE LINFOTOXINA BE}. LOS AGENTES BLOQUEANTES DEL RECEPTOR DE LINFOTOXINA BE} SON UTILES PARA EL TRATAMIENTO DE ENFERMEDADES INMUNOLOGICAS MEDIADAS POR LOS LINFOCITOS Y, MAS CONCRETAMENTE, PARA LA INHIBICION DE LAS RESPUESTAS INMUNES MEDIADAS POR CELULAS TH 1. ESTA INVENCION ESTA RELACIONADA CON FORMAS SOLUBLES DEL CAMPO DE ACTIVIDAD EXTRACELULAR DEL RECEPTOR DE LINFOTOXINA BE} QUE ACTUAN COMO AGENTES BLOQUEANTES DEL RECEPTOR DE LINFOTOXINA BE}. ESTA INVENCION TAMBIEN ESTA RELACIONADA CON EL EMPLEO DE ANTICUERPOS DIRIGIDOS CONTRA EL RECEPTOR DE LINFOTOXINA BE} O SU LIGANDO, LINFOTOXINA DE SUPERFICIE, QUE ACTUAN COMO AGENTES BLOQUEANTES DEL RECEPTOR DE LINFOTOXINA BE}. TAMBIEN SE PROPORCIONA UN NUEVO METODO DE SCREENING PARA SELECCIONAR RECEPTORES SOLUBLES, ANTICUERPOS Y OTROS AGENTES QUE BLOQUEAN LA SEÑALIZACION DEL RECEPTOR LT BE}.

  22. 22.-

    COMPLEJOS DE LINFOTOXINAS-ALFA/BETA Y ANTICUERPOS DE LOS RECEPTORES DE ANTI-LINFOTOXINA-BETA COMO AGENTES ANTITUMORALES.

    (12/2004)
    Inventor/es: MEIER, WERNER, BROWNING, JEFFREY, L., BENJAMIN, CHRISTOPHER D. Clasificación: A61K39/395, G01N33/53, A61K38/21, A61K38/19.

    LA INVENCION SE REFIERE A COMPOSICIONES Y METODOS UTILES PARA ACTIVAR LA SEÑALIZACION DEL RECEPTOR LT VEZ, PRODUCE EFECTOS ANTIPROLIFERATIVOS POTENTES EN LAS CELULAS TUMORALES. MAS PARTICULARMENTE LA INVENCION SE REFIERE A COMPLEJOS HETEROMERICOS DE LINFOTOXINA FORMADOS ENTRE LA LINFOTOXINA NDUCEN EFECTOS CITOTOXICOS EN CELULAS TUMORALES EN PRESENCIA DE AGENTES ACTIVANTES DEL RECEPTOR DE LINFOTOXINA MO LA INVENCION SE REFIERE A ANTICUERPOS DIRIGIDOS CONTRA EL RECEPTOR DE LINFOTOXINA ES DEL RECEPTOR DE LINFOTOXINA ON OTROS AGENTES ACTIVANTES DEL RECEPTOR DE LINFOTOXINA TANTO EN PRESENCIA COMO EN AUSENCIA DE COMPLEJOS DE LINFOTOXINA HOS ANTICUERPOS. ESTA INVENCION SE REFIERE ASIMISMO A COMPOSICIONES Y METODOS QUE UTILIZAN ANTICUERPOS RETICULANTES ANTI-RECEPTOR DE LINFOTOXINA TROS AGENTES ACTIVANTES DEL RECEPTOR DE LINFOTOXINA.

  23. 23.-

    COMPOSICION QUE CONTIENE UN ANTAGONISTA DEL RECEPTOR A1 DE ADENOSINA Y METODO PARA RESTABLECER LA FUNCION DIURETICA Y RENAL.

    (07/2004)
    Inventor/es: BECKMAN, EVAN, SMITS, GLENN. Clasificación: A61P13/12, A61K31/635, A61K31/52.

    Procedimientos y composiciones para restablecer la función diurética y renal que comprenden antagonistas de adenosina A1.

  24. 24.-

    UN INHIBIDOR DE VLA-4: OMEPUPA-V.

    (07/2004)
    Ver ilustración. Inventor/es: LEE, WEN-CHERNG, GILL, ALAN. Clasificación: A61K31/40, C07D207/16.

    Un compuesto de fórmula (I): **FORMULA** o un profármaco farmacéuticamente aceptable, una sal o un isómero del mismo, en donde dicho profármaco es un profármaco de éster.

  25. 25.-

    NUEVOS INHIBIDORES DE LA HEPATITIS B.

    (06/2004)
    Inventor/es: MURRAY, KENNETH, DYSON, MICHAEL, RICHARD. Clasificación: C07K14/00, C07K7/04, C07K14/02.

    LA PRESENTE INVENCION SE REFIERE A PEPTIDOS Y OTRAS MOLECULAS QUE INHIBEN EL CONJUNTO DEL VIRUS DE LA HEPATITIS B, PROCEDIMIENTOS DE TRATAMIENTO ASI COMO A COMPOSICIONES FARMACEUTICAS QUE CONTIENEN DICHOS PEPTIDOS.

  26. 26.-

    CRISTALES DE FRAGMENTOS DEL LIGANDO CD40 Y SU USO.

    (04/2004)
    Ver ilustración. Inventor/es: KARPUSAS, MIHAIL N., SINGH, JUSWINDER, THOMAS, DAVID W. Clasificación: C07K1/00, C07K14/725, G01N33/68, C07K14/525.

    ESTA INVENCION ESTA RELACIONADA CON CRISTALES DE FRAGMENTOS DEL LIGANDO CD40, ESPECIFICAMENTE UN FRAGMENTO SOLUBLE DEL LIGANDO CD40 (116 MPLEO DE ESTOS CRISTALES Y DE LOS COORDINADOS SIMILARES PARA DISEÑAR, IDENTIFICAR, OPTIMIZAR O CARACTERIZAR ENTIDADES QUIMICAS CON PROPIEDADES DE INTERES.

  27. 27.-

    INHIBIDORES DE LA ADHESION CELULAR

    (04/2003)
    Inventor/es: ADAMS, STEVEN, P., LEE, WEN-CHERNG, LIN, KO-CHUNG, SINGH, JUSWINDER, CASTRO, ALFREDO, C., ZIMMERMAN, CRAIG, N., HAMMOND, CHARLES, E., LIAO, YU-SHENG, CUERVO, JULIO, HERNAN. Clasificación: C07D213/75, A61K31/17, C07C271/22, A61K31/27, A61K31/36, C07C275/28, A61K31/16, C07D317/60, C07C237/22, C07C323/52, C07D213/55.

    LA PRESENTE INVENCION SE REFIERE A NUEVOS COMPUESTOS UTILES PARA LA INHIBICION Y PREVENCION DE LA ADHESION CELULAR Y PATOLOGIAS MEDIADAS POR LA ADHESION CELULAR, ASI COMO A FORMULACIONES FARMACEUTICAS QUE INCLUYEN ESTOS COMPUESTOS Y METODOS DE UTILIZACION DE LAS MISMAS PARA LA INHIBICION Y PREVENCION DE LA ADHESION CELULAR Y PATOLOGIAS MEDIADAS POR LA ADHESION CELULAR. LOS COMPUESTOS Y COMPOSICIONES FARMACEUTICAS DE LA INVENCION PUEDEN UTILIZARSE COMO AGENTES TERAPEUTICOS O PROFILACTICOS. SON PARTICULARMENTE ADECUADOS PARA EL TRATAMIENTO DE MUCHAS ENFERMEDADES INFLAMATORIAS Y AUTOINMUNES.

  28. 28.-

    METODOS PARA MEJORAR LA TOLERANCIA DE ALOINJERTOS O XENOINJERTOS POR ADMINISTRACION DE PROTEINAS DE FIJACION LFA-3 O CD2.

    (07/2002)
    Inventor/es: WALLNER, BARBARA, BENJAMIN, CHRISTOPHER. Clasificación: A61K38/17.

    PROTEINA QUE UNE CD2, QUE ES UN DERIVADO DE UN POLIPEPTIDO LFA3 SOLUBLE, SIENDO EL DERIVADO UNA FUSION DE INMUNOGLOBULINA QUE INCLUYE EL POLIPEPTIDO LFA-3 FUSIONADO CON UNA ZONA DE INMUNOGLOBULINA, O ESTANDO EL POLIPEPTIDO LFA-3 SOLUBLE UNIDO A UN AGENTE FARMACEUTICO, Y QUE SE UTILIZA EN LA PREPARACION DE UN MEDICAMENTO PARA UTILIZAR EN UN METODO DE MEJORAR LA TOLERANCIA DEL TEJIDO ALOINJERTADO O XENOINJERTADO TRASPLANTADO EN UN MAMIFERO, INCLUYENDO UN SER HUMANO, DE FORMA QUE EL METODO INCLUYE EL IMPLANTE EN EL MAMIFERO DE UN ALOINJERTO O XENOINJERTO Y LA ADMINISTRACION DE LA PROTEINA.

  29. 29.-

    INHIBIDORES MEJORADOS DE TROMBINA.

    (11/2000)

    LA INVENCION SE REFIERE A NUEVAS MOLECULAS BIOLOGICAMENTE ACTIVAS QUE SE UNEN E INHIBEN LA TROMBINA. ESTAS MOLECULAS COMPRENDEN UNA MITAD DIRIGIDA DE ZONA CATALITICA (CSDM) DE LA FORMULA (I), EN DONDE X ES HIDROGENO O SE CARACTERIZA DE UNA CADENA DE RESPALDO QUE CONSTA DE ENTRE 1 Y 100 ATOMOS, R1 SE SELECCIONA ENTRE EL GRUPO QUE CONSTA DE ESTRUCTURAS DE ANILLO SATURADAS MONO, DI O TRISUBSTITUIDAS O INSUBSTITUIDAS; R2 ES UN ENLACE O SE CARACTERIZA POR UNA CADENA DE RESPALDO QUE CONSTA DE ENTRE 1 Y 5 ATOMOS; R3 ES UN ENLACE O SE CARACTERIZA POR UNA CADENA DE RESPALDO QUE CONSTA DE ENTRE 1 Y 3 ATOMOS; R4 ES CUALQUIER ACIDO AMINO; R5 ES CUALQUIER ACIDO L-AMINO QUE COMPRENDA UN GRUPO DE...

  30. 30.-

    DOMINIO DE UNION A CD2 DEL ANTIGENO 3 ASOCIADO CON LA FUNCION LINFOCITICA.

    (09/2000)
    Inventor/es: ROSA, MARGARET D., WALLNER, BARBARA, P., MILLER, GLENN T. Clasificación: C07K14/00, C12N15/12, C12N15/62, A61K39/395, G01N33/566, A61K38/00, C12N1/21, G01N33/564.

    SE PRESENTAN POLIPEPTIDOS Y PROTEINAS QUE CONTIENEN EL DOMINIO DE UNION CD2 DEL LFA-3. TAMBIEN SE PRESENTAN LAS SECUENCIAS DE ADN QUE CODIFICAN LA EXPRESION DE ESOS POLIPEPTIDOS Y PROTEINAS, LOS METODOS PARA LA PRODUCCION Y USO DE TALES POLIPEPTIDOS Y PROTEINAS Y LAS COMPOSICIONES DE DIAGNOSTICO Y TERAPEUTICAS. TAMBIEN SE PRESENTAN LOS MUTANTES DE DETECCION INCAPACES DE UNIRSE AL CD2 Y LOS METODOS PARA SU USO. SE PRESENTAN ADEMAS LAS PROTEINAS DE FUSION QUE CONTIENEN EL DOMINIO AGLUTINANTE CD2 DEL LFA-3 Y UNA PORCION DE UNA PROTEINA DISTINTA DEL LFA-3, LAS SECUENCIAS DE ADN QUE CODIFICAN ESAS PROTEINAS DE FUSION, LOS METODOS PARA LA PRODUCCION DE TALES PROTEINAS DE FUSION Y LOS USOS DE DICHAS PROTEINAS DE FUSION.

  31. 31.-

    MOLECULAS DE ANTICUERPO ANTI-VLA4 RECOMBINANTE.

    (12/1999)
    Inventor/es: LOBB, ROY R., CARR, FRANK J., TEMPEST, PHILIP, R. Clasificación: C12N15/13, C07K16/28, A61K39/395, C12P21/08.

    EN LA PRESENTE INVENCION SE PRESENTAN MOLECULAS DE ANTICUERPOS ANTI-VLA4 RECOMBINANTES, INCLUIDAS LAS MOLECULAS DE ANTICUERPOS ANTI-VLA4 RECOMBINANTES HUMANIZADAS. ESTOS ANTICUERPOS SON UTILES PARA EL TRATAMIENTO DE INFLAMACIONES ESPECIFICAS Y NO ESPECIFICAS, INCLUIDOS EL ASMA Y ENFERMEDADES DE INFLAMACION INTESTINAL. ADEMAS LOS ANTICUERPOS ANTI-VLA4 RECOMBINANTES HUMANIZADOS PRESENTADOS PUEDEN SER UTILES EN METODOS DE DIAGNOSTICO Y LOCALIZACION DE LUGARES INFLAMADOS.

  32. 32.-

    POLIPEPTIDOS DE TRANSPORTE DERIVADOS DE LA PROTEINA TAT.

    (01/1999)
    Inventor/es: BARSOUM, JAMES, G., PEPINSKY, R., BLAKE, FAWELL, STEPHEN, E. Clasificación: C07K14/00, C12N15/62, C12N5/10, C12N15/31, A61K39/21, C12N15/87, C12N9/02, C12N15/37, C12N15/49, C12N9/22, C12N1/11.

    ESTE INVENTO SE REFIERE A LA LIBERACION DE MOLECULAS DE CARGA BIOLOGICAMENTE ACTIVA, TALES COMO POLIPEPTIDOS Y ACIDOS NUCLEICOS, EN EL CITOPLASMA Y EL NUCLEO DE CELULAS "IN VITRO" E "IN VIVO", MEDIANTE EL EMPLEO DE NUEVOS POLIPEPTIDOS DE TRANSPORTE QUE COMPRENDEN UNA O MAS PARTES DE PROTEINA TAT DE HIV Y QUE ESTAN ENLAZADOS CONVALENTEMENTE A MOLECULAS DE CARGA. LOS POLIPEPTIDOS DE TRANSPORTE DE ESTE INVENTO SE CARACTERIZAN POR LA PRESENCIA DE LA REGION BASICA SALIENTE (AMINO ACIDOS 49 - 57), LA AUSENCIA DE REGION RICA EN CISTEINA SALIENTE (AMINO ACIDOS 22 - 36) Y LA AUSENCIA DEL DOMINIO DE TERMINAL CARBOXI CODIFICADO - 2 EXON TAT (AMINO ACIDOS 73 - 86) DE LA PROTEINA TAT QUE SE PRESENTA NATURALMENTE. LA AUSENCIA DE LA REGION RICA EN CISTEINA ENCONTRADA EN PROTEINAS TAT CONVENCIONALES RESUELVE LOS PROBLEMAS DE TRANSACTIVACION ESPUREA Y AGREGACION DE DISULFURO.

1 · >>