49 patentes, modelos y diseños de AMYLIN PHARMACEUTICALS, INC.

  1. 1.-

    Exendinas para disminuir el colesterol y los triglicéridos

    (12/2015)

    Una formulación que comprende una exendina-4 o un análogo de la misma para su uso en un método para disminuir los niveles de colesterol total, los niveles de colesterol LDL, o los niveles de triglicéridos en un paciente que necesita el mismo, comprendiendo el método: identificar un paciente que necesite una reducción de los niveles de colesterol total, niveles de colesterol LDL, o niveles de triglicéridos; y administrar al paciente una formulación farmacéutica una vez a la semana en una cantidad suficiente para mantener un estado estable de la media geométrica...

  2. 2.-

    Utilización de exendinas y sus agonistas para el tratamiento de la hipertrigliceridemia

    (07/2014)

    La utilización de una exendina o un agonista de exendina en la fabricación de un medicamento para el uso en el tratamiento de la hipertrigliceridemia en sujetos humanos o animales.

  3. 3.-

    Compuestos novedosos agonistas de exendina

    (07/2013)

    Compuesto peptídico de fórmula [I] [SEQ. ID. NO. 4] en el que dicho compuesto peptídico muestra actividad agonista de exendina: Xaa1 Xaa2 Xaa3 Xaa4 Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10 Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19 Xaa20 Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1; en el que Xaa1 es His, Arg, Tyr, Ala, Norval, Val o Norleu; Xaa2 es Ser, Gly, Ala o Thr; Xaa3 es Ala, Asp o Glu; Xaa4 es Ala, Norval, Val, Norleu o Gly; Xaa5 es Ala o Thr; Xaa6 es Phe, Tyr o naftilalanina; Xaa7 es Thr o Ser; Xaa8 es Ala, Ser o Thr; Xaa9 es Ala, Norval, Val, Norleu, Asp o Glu;...

  4. 4.-

    Regulación de la motilidad gastrointestinal

    (06/2013)

    SE PRESENTAN PROCEDIMIENTOS PARA REDUCIR LA MOTILIDAD GASTRICA Y RETRASAR EL VACIADO GASTRICO PARA PROPOSITOS TERAPEUTICOS Y DE DIAGNOSTICO, EL PROCEDIMIENTOS COMPRENDE LA ADMINISTRACION DE UNA CANTIDAD EFECTIVA DE UNA EXENDINA O DE UN AGONISTA DE LA EXENDINA. SE PRESENTAN PROCEDIMIENTOS PARA TRATAR ESTADOS ASOCIADOS CON NIVELES DE GLUCOSA EN SANGRE ELEVADOS, INAPROPIADOS O INDESEADOS QUE COMPRENDEN LA ADMINISTRACION DE UNA CANTIDAD EFECTIVA DE UNA EXENDINA O DE UN AGONISTA DE LA EXENDINA SOLOS O EN CONJUNCION CON OTROS AGENTES PARA RETRASAR...

  5. 5.-

    Péptidos FN-38 para su uso en el tratamiento de desórdenes psicóticos y de ansiedad

    (06/2012)

    Un péptido FN-38 que tiene al menos un 80% de identidad de la secuencia con el péptido que se compone de lasecuencia de aminoácidos FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN-NH2 (SEC. ID. Nº: 5) parautilizarlo en el tratamiento de un trastorno psicótico o un trastorno de ansiedad en un sujeto que lo necesita.

  6. 6.-

    DISPOSITIVO DE LIBERACIÓN SOSTENIDA A BASE DE POLÍMERO

    (03/2012)

    Una composición para la liberación sostenida de un polipéptido biológicamente activo, que comprende un polímero biocompatible que tiene el polipéptido biológicamente activo disperso en el mismo de forma que esté presente en un 5% (p/p) del peso de la composición, y sacarosa dispersada en el mismo de forma que está presente en un 2% (p/p) del peso de la composición, en la que el polipéptido biológicamente activo es exendina-4; en la que el volumen total de poros de la composición es de 0,1 ml/g o...

  7. 7.-

    MÉTODOS Y COMPOSICIONES PARA EL TRATAMIENTO DEL SÍNDROME DE OVARIO POLIQUÍSTICO

    (01/2012)

    Composición que comprende una molécula de GLP-1 seleccionada de entre GLP-1 (SEC ID N.º: 1), GLP-1 NH2 (SEC ID N.º: 2), GLP-1 (SEC ID N.º: 3), GLP-1 NH2 (SEC ID N.º: 4), exendina-3 (SEC ID N.º: 7), exendina-4 (SEC ID N.º: 9) o una variante biológicamente activa que presente más del 90% identidad de la secuencia con cualquiera de las SEC ID 1 a 4, para utilizar en el tratamiento de una paciente que padece poliquistosis ovárica (PCOS) - en la que el paciente presenta por lo menos un síntoma indicativo de...

  8. 8.-

    FORMULACIONES FARMACÉUTICAS QUE COMPRENDEN PÉPTIDO DE INCRETINA Y UN DISOLVENTE POLAR APRÓTICO

    (10/2011)

    Formulación farmacéutica estable que comprende una incretina o un péptido mimético de incretina y al menos un disolvente aprótico polar y al menos un excipiente estabilizante seleccionado de entre el grupo constituido por: agua, un azúcar y un alcohol de azúcar

  9. 9.-

    LIGACIÓN QUÍMICA "SEUDO"- NATURAL

    (06/2011)

    Procedimiento para sintetizar un polipéptido deseado de fórmula: aaNH2-Q-aax-aay-W-aaCOOH en la que Q y W indican cada uno la presencia opcional de uno o más restos de aminoácidos adicionales, aaNH2 indica el resto de aminoácido con terminal N del polipéptido; aax y aay indican los restos de aminoácidos adyacentes internos, que presentan las cadenas laterales x e y, respectivamente, y en la que aay es un resto de aminoácido no especificado ribosómicamente y aaCOOH indica el resto de aminoácido con terminal C del polipéptido;...

  10. 10.-

    COMPOSICIÓN FARMACÉUTICA QUE COMPRENDE UN PÉPTIDO DE EXENDINA-4

    (05/2011)

    Composición farmacéutica que comprende un péptido de exendina-4 que presenta la secuencia de aminoácidos HGEGTFTSDL SKQMEEEAVR LFIEWLKNGG PSSGAPPPS en una cantidad comprendida entre 0,001 mg y 1 mg apta para un paciente de 70 kg; una disolución amortiguadora farmacéuticamente aceptable; un agente de isotonicidad farmacéuticamente aceptable; y un excipiente farmacéuticamente aceptable

  11. 11.-

    NUEVOS COMPUESTOS DE ACTIVIDAD MIXTA DE LA AMILINA

    (04/2011)

    Compuesto de fórmula: X1-X2-X3-Leu-X4-Glu-Leu-X5-X6-Leu-Gln-Thr-Tyr-Pro-Arg- Thr-Asn-X7-Z3 [SEC ID nº 27] en la que: (a) X1 es Z1-Ser-Thr-Z2-Val-Leu [SEC ID nº 28], en la que Z1 es un grupo alcanoílo; y Z2 es un residuo aminoácido seleccionado de entre el grupo constituido por Ala, Ser, Cys, y Thr; (b) X2 es un residuo aminoácido seleccionado de entre el grupo constituido por Gly, Glu, Asn o Aib; (c) X3 es un residuo aminoácido seleccionado de entre el grupo constituido por Arg, Orn, Lys y Lys E-amidado con ácido acético; (d) X4 es un grupo de dos residuos aminoácidos seleccionados de entre el grupo constituido por Ser-Gln, Thr-Gln, Ala-Asn y Thr-Asn; (e) X5 es un residuo aminoácido seleccionado...

  12. 12.-

    LIGADURA EXTENDIDA DE CADENA LATERAL

    (03/2011)

    Procedimiento de ligadura de componentes a través de un enlace amida, comprendiendo dicho procedimiento: poner en contacto un componente de fórmula J1-C(O)SR con un componente de fórmula NH2-CH(XSH)-J2 en condiciones suficientes para formar un producto de ligadura sustituido con tiol que presenta la fórmula J1-C(O)-NH- CH(XSH)-J2, en la que J 1 es un residuo de una primera molécula diana, polímero o superficie; R es un grupo compatible con tioésteres; XSH es una cadena lateral de aminoácido ramificado que presenta un auxiliar tiol extraíble y se selecciona de entre el grupo constituido por un auxiliar ß-mercapto de fórmula -CH(R')-SH y un auxiliar γ-mercapto de fórmula -CH2-...

  13. 13.-

    ADMINISTRACIÓN INTRANASAL DE PÉPTIDOS REGULADORES DE GLUCOSA

    (01/2011)

    Formulación farmacéutica para liberación intranasal, que comprende: un péptido regulador de glucosa seleccionado entre un péptido de amilina, pramlintida, un péptido GLP-1 o una extendina; agua; una ciclodextrina; y un fosfolípido

  14. 14.-

    PEPTIDOS DE LA FAMILIA AMILINA Y METODOS PARA SU OBTENCION Y UTILIZACION

    (09/2010)

    Péptido de la familia amilina, en el que el péptido comprende la secuencia de SEC ID nº: 137, o la secuencia de SEC ID nº: 137 que incluye una sustitución, inserción o supresión de aminoácidos, en el que el péptido reduce la ingesta de alimentos

  15. 15.-

    EXENDINA PARA LA SUPRESION DEL GLUCAGON

    (07/2010)

    Compuesto que es una exendina, agonista de la exendina, o exendina modificada o agonista modificado de la exendina para utilizar en la disminución terapéutica del nivel plasmático de glucagón en pacientes diabéticos o intolerantes a la glucosa con unos niveles plasmáticos de glucagón que son superiores a los de las personas sanas, en el que la exendina, agonista de la exendina, o exendina modificada o agonista modificado de la exendina comprende una secuencia de aminoácidos con la fórmula:

  16. 16.-

    DESPROTECCION DEL AZUFRE POSTERIOR A LA ESCISION PARA LA SINTESIS CONVERGENTE DE PROTEINAS MEDIANTE LIGACION QUIMICA

    (06/2010)

    Compuesto de fórmula: Xaai- ... -Xaam-(CH-R)-CO-O-C*H[(CH2)n-S-R'']-Y en la que: Xaai es un aminoácido protegido o no protegido para i=1 a m; m es un número entero entre 2 y 200; n es un número entero entre 1 y 10; C* es un carbono quiral en configuración R o S, y sustancialmente libre de la configuración contraria; R es una cadena lateral de un aminoácido; R'' es -SR'''', Y es un grupo aceptor de electrones seleccionado de entre el grupo que consiste de Rc, alquilo C1-3 sustituido con 1 a 3 grupos Rc, -C(O)-Rd, -S(O)p-alquilo C1-3 sustituido con 0 a 3 grupos Rc, y un arilo sustituido con 1 a 3 grupos Rc; cada grupo Rc es independientemente un elemento seleccionado...

  17. 17.-

    AMILINA Y AGONISTAS DE AMILINA PARA EL TRATAMIENTO DE ENFERMEDADES Y TRASTORNOS PSIQUIATRICOS

    (12/2009)
    Ver ilustración. Inventor/es: YOUNG, ANDREW, A., LAUGERO,KEVIN D, HANLEY,MICHAEL, MACK,CHRISTINE M, PARKES,DAVID G. Clasificación: A61K38/22, A61P25/18, A61K38/00, A61K38/16.

    Utilización de una amilina, un agonista de la amilina, un análogo de la amilina o un derivado de la amilina seleccionados de entre el grupo constituido por un compuesto según la SEC. ID. nº: 3, SEC. ID. nº: 33, SEC. ID. nº: 35, SEC. ID. nº: 67, SEC. ID. nº: 80 o SEC. ID. nº: 83, para la preparación de un medicamento destinado al tratamiento de una enfermedad o trastorno psiquiátrico, en la que la enfermedad o el trastorno es un trastorno del estado de ánimo, un trastorno de ansiedad o esquizofrenia, en la que el medicamento debe administrarse en una cantidad eficaz para tratar la enfermedad o trastorno.

  18. 18.-

    TRATAMIENTO DE LA OBESIDAD Y LOS TRASTORNOS RELACIONADOS

    (09/2009)
    Ver ilustración. Inventor/es: ROTH,JONATHAN, ANDERSON,CHRISTEN,M, BARON,ALAIN. Clasificación: A61K45/06.

    Utilización de un primer agente antiobesidad seleccionado de entre amilina, un agonista de amilina o un análogo de amilina para la preparación de un medicamento para reducir el peso corporal en un sujeto humano, para tratar la obesidad o reducir la disponibilidad de nutrientes, en la que el medicamento debe ser administrado en combinación con un segundo agente antiobesidad seleccionado de entre leptina, un derivado de leptina o un agonista de leptina, en la que los agentes deben ser administrados en cantidades eficaces para reducir el peso corporal del sujeto en por lo menos 10%, y en la que la concentración de leptina sérica del sujeto es superior a 10 ng/ml antes de la administración de los agentes antiobesidad.

  19. 19.-

    METODOS PARA REGULAR LA MOTILIDAD GASTROINTESTINAL

    (05/2009)
    Ver ilustración. Inventor/es: BEELEY, NIGEL, ROBERT, ARNOLD, PRICKETT, KATHRYN, S., YOUNG, ANDREW, A., GEDULIN,BRONISLAVA. Clasificación: A61K38/00, C07K5/00, C07K2/00, A61K38/26, G03F5/00.

    SE PRESENTAN PROCEDIMIENTOS PARA REDUCIR LA MOTILIDAD GASTRICA Y RETRASAR EL VACIADO GASTRICO PARA PROPOSITOS TERAPEUTICOS Y DE DIAGNOSTICO, EL PROCEDIMIENTOS COMPRENDE LA ADMINISTRACION DE UNA CANTIDAD EFECTIVA DE UNA EXENDINA O DE UN AGONISTA DE LA EXENDINA. SE PRESENTAN PROCEDIMIENTOS PARA TRATAR ESTADOS ASOCIADOS CON NIVELES DE GLUCOSA EN SANGRE ELEVADOS, INAPROPIADOS O INDESEADOS QUE COMPRENDEN LA ADMINISTRACION DE UNA CANTIDAD EFECTIVA DE UNA EXENDINA O DE UN AGONISTA DE LA EXENDINA SOLOS O EN CONJUNCION CON OTROS AGENTES PARA RETRASAR EL VACIADO GASTRICO.

  20. 20.-

    USO DE AGONISTAS DE AMILINA PARA MODULAR TRIGLICERIDOS

    (04/2009)
    Ver ilustración. Inventor/es: KOLTERMAN, ORVILLE G., WEYER,CHRISTIAN, MAGGS,DAVID,G, FINEMAN,MARK. Clasificación: A61P3/06, A61K38/22.

    Uso de una composición que comprende una amilina o agonista de amilina para la fabricación de un medicamento para tratar la dislipidemia en un paciente, en el que el medicamento reduce las excursiones de triglicérido postprandial y en donde el agonista de amilina es un análogo de amilina o un derivado de amilina.

  21. 21.-

    PROCEDIMIENTO Y APARATO DE CORTE DE PRODUCTOS ALIMENTICIOS

    (04/2009)
    Ver ilustración. Inventor/es: HATHAWAY, DAVID, R., BARON, ALAIN, D., MISTRY,MAHESH, ROMAN,RICHARD,J. Clasificación: B26D7/06.

    Un sensor colorimétrico para detectar un analito, que comprende: un receptor y y una composición polimerizada que comprende al menos un compuesto de fórmula: (Ver fórmula) en la que R 1 comprende (Ver fórmula) R 2 comprende (Ver fórmula).

  22. 22.-

    FORMULACIONES PARA PEPTIDOS AGONISTAS DE AMILINA CON INSULINA

    (04/2009)

    Una mezcla obtenible mezclando insulina y una formulación farmacéutica líquida, en donde la formulación farmacéutica comprende del 0,01% al 0,5% (peso/volumen) de un agonista de amilina, en donde dicho agonista de amilina es un análogo peptídico de la amilina humana, mezclado con un agente de tonicidad hidrato de carbono o alcohol polihídrico, estando suministrado dicho agente de tonicidad en una cantidad de entre el 1,0% y el 10% (peso/volumen), y del 0,02% al 0,5% (peso/volumen) de un tampón acetato, fosfato, citrato o glutamato, teniendo dicha formulación un pH de 3,8 a 4,2, y un conservante seleccionado del grupo que consiste en m-cresol, alcohol bencílico, metil, etil, propil y butil parabenos, y fenol, estando...

  23. 23.-

    PROCEDIMIENTO PARA PREVENIR GASTRITIS USANDO AMILINA O AGONISTAS DE AMILINA

    (07/2008)

    Uso de una amilina o un análogo de agonista de amilina seleccionado entre el grupo que consiste en: i) Un análogo de agonista de amilina que tiene la secuencia de aminoácidos: 1 A1-X-Asn-Thr- 5 Ala-Thr-Y-Ala-Thr- 10 Gln-Arg-Leu-B 1-Asn- 15 Phe-Leu-C 1-D 1-E 1- 20 F 1-G 1-Asn-H 1-Gly- 25 Pro-I 1- Leu-Pro-J 1- 30 Thr-K 1-Val-Gly-Ser- 35 Asn-Thr-Tyr-Z en la que A 1 es Lys, Ala, Ser o hidrógeno; B1 es Ala, Ser o Thr; C 1 es Val, Leu o Ile; D1 es His o Arg; E 1 es Ser o Thr; F1 es Ser, Thr, Gln o Asn; G1 es Asn, Gln o His; H 1 es Phe,...

  24. 24.-

    COMPUESTOS NOVEDOSOS AGONISTAS DE EXENDINA

    (05/2008)

    Compuesto peptídico de fórmula [I] [SEQ. ID. NO. 4] en el que dicho compuesto peptídico muestra actividad agonista de exendina: Xaa1 Xaa2 Xaa3 Xaa4 Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10 Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Ala Xaa19 Xaa20 Xaa21 Xaa22 Xaa23 Xaa24 Xaa25 Xaa26 Xaa27 Xaa28-Z1; en el que Xaa1 es His, Arg, Tyr, Ala, Norval, Val o Norleu; Xaa2 es Ser, Gly, Ala o Thr; Xaa3 es Ala, Asp o Glu; Xaa4 es Ala, Norval, Val, Norleu o Gly; Xaa5 es Ala o Thr; Xaa6 es Phe, Tyr o naftilalanina; Xaa7 es Thr o Ser; Xaa8 es Ala, Ser o Thr; Xaa9 es Ala, Norval, Val, Norleu, Asp o Glu; Xaa10 es Ala, Leu, Ile, Val, pentilglicina o Met; Xaa11 es Ala o Ser; Xaa12 es Ala o Lys; Xaa13 es Ala o Gln; Xaa14 es Ala, Leu, Ile, pentilglicina, Val o Met; Xaa15...

  25. 25.-

    COMPUESTOS NOVEDOSOS DE AGONISTAS DE EXENDINA

    (04/2008)
    Ver ilustración. Inventor/es: BEELEY, NIGEL, ROBERT, ARNOLD, PRICKETT, KATHRYN, S.. Clasificación: A61K38/28, A61P3/10, C07K14/435, A61K38/00, C07K14/575, C07K14/46, A61K38/16.

    Compuesto peptídico de fórmula (I) [SEQ. ID. NO: 4], en el que dicho compuesto peptídico muestra actividad de agonista de exendina, compuesto que tiene una secuencia de aminoácidos seleccionada de las SEQ. ID. NO: 11, 13, 14, 15, 18, 19, 23, 24 y 27.

  26. 26.-

    NUEVOS COMPUESTOS ANALOGOS DE LA EXENDINA

    (03/2008)
    Ver ilustración. Inventor/es: BEELEY, NIGEL, ROBERT, ARNOLD, PRICKETT, KATHRYN, S.. Clasificación: A61P3/10, A61K38/00, C07K14/575, C07K14/46, A61K38/16.

    Un compuesto peptídico de la fórmula (I) [SEQ ID NO: 4], en donde dicho compuesto peptídico exhibe actividad agonista de exendina como agente para regular la motilidad gástrica y retardar el vaciamiento del estómago, en donde dicho compuesto tiene una secuencia de aminoácidos seleccionada de SEQ ID NOs: 5, 6, 7, 17, 18, 19, 22, 24, 31, 32 y 35.

  27. 27.-

    UTILIZACION DE LAS EXENDINAS Y DE AGONISTAS DE LAS MISMAS EN EL TRATAMIENTO DE LA DIABETES MELLITUS GESTACIONAL

    (02/2008)

    Utilización de una exendina o de un péptido agonista de la exendina en la fabricación de un medicamento para el tratamiento de la diabetes gestacional en una paciente, comprendiendo dicho medicamento una cantidad terapéuticamente eficaz de una exendina o de un péptido agonista de la exendina en la que dicha exendina o péptido agonista de la exendina se enlaza con un receptor que se enlaza con la exendina-3 o la exendina-4, y en la que dicha exendina o péptido agonista de la exendina comprende la secuencia Xaa1 Xaa2 Xaa3 Gly Thr Xaa4 Xaa5 Xaa6 Xaa7 Xaa8 Ser Lys Gln Xaa9 Glu Glu Glu Ala Val Arg Leu Xaa10 Xaa11 Xaa12...

  28. 28.-

    EFECTOS INOTROPICOS Y DIURETICOS DE LA EXENDINA Y GLP-1

    (02/2008)
    Ver ilustración. Inventor/es: YOUNG, ANDREW, A., VINE,WILL, BEELEY,NIGEL,R.,A, PRICKETT,KATHRYN. Clasificación: A61K31/00, A61P15/00, A61K45/00, A61K35/74, A61P3/12, A61P13/12, A61K38/00, A61P13/00, A61P9/04, A61P9/12, A61P13/02, A61K38/26, A61P7/10.

    Un uso de un compuesto para fabricar un medicamento para tratar, prevenir o aliviar una afección o trastorno asociados con la hipervolemia tóxica en un individuo, en el que dicho compuesto se selecciona del grupo constituido por: (a) una exendina o un agonista de exendina, y (b) un GLP-1 o un agonista de GLP-1.

  29. 29.-

    NUEVOS PEPTIDOS ANTIDIABETICOS

    (10/2007)

    Compuesto con la fórmula: X1 - Xaa1 - X2 - Xaa2 - X3 - Xaa3 - X4 - Xaa4 - X5 - Xaa5 - X6 - NH2 en la que X1 es Lys, Arg o falta; X2 es Xaa6 Xaa7 Xaa8 Xaa9 (SEC. ID. Nº 47) o Z-Xaa10 Ser Thr, con la condición de que cuando X2 sea Z-Xaa10 Ser Thr, falten tanto X1 como Xaa1; X3 es Ala Thr, Ala Ser, Ser Met, Glu Thr o Val Thr; X4 es Arg Leu Ala, His Leu Ala, Arg Ile Ala, Lys Ile Ala, Arg Met Ala, His Met Ala, Lys Met Ala o Arg Leu Thr; X5 es Phe Leu, Phe Ile, Phe Met, Tyr Leu, Tyr Ile, Tyr Met, Trp Met o Trp Ile; X6 es Arg Ser Ser Gly Tyr (SEC. ID. Nº 48), Lys Ser Ser Gly Tyr (SEC. ID. Nº 49), His Ser Ser Gly Tyr (SEC. ID. Nº 50), Pro Ser Ser Gly Tyr (SEC. ID....

  30. 30.-

    EXCENDINAS DESTINADAS A LA INHIBICION DE GLUCAGON

    (08/2007)

    Utilización de una exendina, agonista de la exendina, o exendina modificada o agonista modificado de la exendina en la fabricación de una formulación farmacéutica a utilizar en el tratamiento de la hiperglucagonemia, el glucagonoma o el eritema necrolítico migratorio, en el que la exendina, agonista de la exendina, o exendina modificada o agonista modificado de la exendina comprende una secuencia de aminoácidos con la fórmula: 1 5 10 Xaa1 Xaa2 Xaa3 Gly Thr Xaa4 Xaa5 Xaa6 Xaa7 Xaa8 15 20 Ser Lys Gln Xaa9 Glu Glu Glu Ala Val Arg Leu 25 30 Xaa10 Xaa11 Xaa12 Xaa13...

  31. 31.-

    DISPOSICIONES DE CIERRE HERMETICO DE LIQUIDOS PARA DEPOSITOS REEMPLAZABLES DE LIQUIDOS.

    (04/2007)

    Un obturador y portamecha que comprende una pieza unitaria moldeada de plástico, que incluye: una primera pared tubular , generalmente vertical, para contener una mecha ; una segunda pared tubular , generalmente vertical, que se extiende alrededor de - y y es concéntrica con - dicha primera pared tubular ; una pared superior , generalmente horizontal, que se puede instalar sobre la parte superior de un cuello de botella, cuya pared superior es integral con - y se extiende radialmente hacia fuera de - dicha segunda pared tubular cerca de su extremo superior; una falda circunferencial que se extiende hacia abajo desde el borde exterior de dicha pared superior extendida radialmente, cuya falda está formada, en su superficie...

  32. 32.-

    USO DE LAS EXENDINAS Y DE LOS AGONISTAS DE LAS MISMAS PARA LA REDUCCION DE LA INGESTA ALIMENTICIA.

    (03/2006)
    Inventor/es: BEELEY, NIGEL, ROBERT, ARNOLD, PRICKETT, KATHRYN, S., BHAVSAR, SUNIL. Clasificación: A61K38/22, C07K14/575, A61K38/16.

    Se describen procedimientos para tratar estados o alteraciones que pueden aliviarse reduciendo la ingestión de alimentos que comprenden la administración de una cantidad eficaz de una exedina o una agonista de la exedina, solo o en combinación con otros compuestos o composiciones que producen saciedad. Los procedimientos son útiles para tratar los estados o las alteraciones, como la obesidad, la diabetes de tipo II, los problemas alimentarios y síndrome insulinoresistente. Estos procedimientos son igualmente útiles para hacer disminuir el nivel de glucosa, bajando el nivel lipídico en el plasma, reduciendo el riesgo cardíaco, reduciendo el apetito, y reduciendo el peso de los sujetos. También se describen composiciones farmacéuticas para uso en los procedimientos de esta invención.

1 · >>