9 patentes, modelos y diseños de AFFIRIS AG

  1. 1.-

    Mimotopos de alfa-sinucleína y vacunas de los mismos para el tratamiento de los trastornos neurodegenerativos

    (11/2015)

    Por lo menos un compuesto que comprende un péptido que presenta la secuencia de aminoácidos seleccionada de entre el grupo que consiste en CDQPVLPD, CDMPVLPD, CDSPVLPD, CDQPVLPDN, CDMPVLPDN, CDSPVLPDN, CHDRPVTPD, CDRPVTPD, CDVPVLPD, CDTPVYPD, CDTPVIPD, CHDRPVTPDN, CDRPVTPDN, CDVPVLPDN, CDTPVYPDN, CDQPVLPDG, CDMPVLPDG, CDSPVLPDG, CDHPVHPDS, CDMPVSPDR, CDRPVYPDI, CDHPVTPDR, CDTPVLPDS, CDMPVTPDT, CDAPVTPDT, CDSPVVPDN, CDLPVTPDR, CDSPVHPDT, CDAPVRPDS, CDMPVWPDG, CDRPVQPDR, CYDRPVQPDR, CDMPVDADN, DQPVLPDC y DMPVLPDC, para la utilización...

  2. 2.-

    Fragmentos de PTEC

    (07/2015)

    Péptido que consiste en 6 a 20 residuos aminoácidos y que deriva de la secuencia de aminoácidos VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEC ID nº 23), en el que dicho péptido comprende la secuencia de aminoácidos WWLGID (SEC ID nº 24).

  3. 3.-

    Vacuna

    (04/2015)

    Vacuna para la utilización en el tratamiento y/o la prevención de un trastorno físico asociado al sistema de la angiotensina activado por la renina, que comprende un péptido unido a un portador farmacéuticamente aceptable, caracterizada por que el péptido se selecciona de entre el grupo que consiste en DRAYAHPF, DPGYIHPF y PGYIHPF, y en la que el portador se une al péptido mediante por lo menos un residuo de cisteína unido al extremo N del péptido.

  4. 4.-

    Procedimiento para detectar anticuerpos Aß-específicos en una muestra biológica

    (07/2014)

    Procedimiento para detectar anticuerpos Aß-específicos en una muestra biológica, que comprende las etapas siguientes: - poner en contacto la muestra con agregados Aß o con perlas con agregados Aβ inmovilizados en su superficie, y permitir que los anticuerpos Aß específicos se unan a los agregados Aß, y - detectar los anticuerpos Aβ-específicos que están unidos a los agregados Aβ, mediante una técnica de detección de partículas individuales, preferentemente mediante la clasificación de células activadas por fluorescencia (FACS).

  5. 5.-

    Péptidos para tratar las beta-amiloidosis

    (03/2014)

    Utilización de por lo menos un compuesto que comprende una secuencia de aminoácidos seleccionada de entre el grupo que consiste en SEFKHG(C), TLHEFRH(C), ILFRHG(C), TSVFRH(C), SQFRHY(C), LMFRHN(C), SPNQFRH(C), ELFKHHL(C), THTDFRH(C), DEHPFRH(C), QSEFKHW(C), ADHDFRH(C), YEFRHAQ(C) y TEFRHKA(C) para producir un medicamento destinado a la prevención y/o al tratamiento de la b-amiloidosis

  6. 6.-

    Tratamiento de la aterosclerosis

    (10/2013)

    Compuesto que comprende la secuencia aminoácida FGFPAHVFIDWLQSLS o FGFPAHVYIDWLQSLS oFGFPAHVFIDWLQSLN para su utilización en la prevención y/o el tratamiento de la aterosclerosis, enfermedadoclusiva arterial periférica, enfermedad cardiaca coronaria o lesión cerebral apopléjica.

  7. 7.-

    Terapia combinada para la prevención o tratamiento de la enfermedad de Alzheimer y kit correspondiente

    (07/2013)

    Kit destinado a ser utilizado para la prevención o tratamiento de la enfermedad de Alzheimer (EA), que comprende - un agente para la inducción de una secuestración de β-amiloide (Aβ) en el plasma, estando seleccionado elagente para la inducción de una secuestración de Aβ en el plasma de entre el grupo constituido por gelsolina,GM1, anticuerpos específicos para Aβ o una vacuna activa o pasiva específica para Aβ y - un dispositivo de aféresis, que comprende un soporte sólido que puede entrar en contacto con el flujo sanguíneoo de plasma, que presenta un receptor de unión a una proteína precursora de ß-amiloide (APP),...

  8. 8.-

    Compuestos peptídicos para tratar amiloidosis

    (09/2012)

    Utilización de por lo menos un compuesto que comprende la secuencia de aminoácidos (X1) mHX2X3X4X5FX6 (X7) n (Fórmula II), en la que X1 es serina (S), treonina (T) o cisteína (C), X2 es la glutamina (Q), treonina (T) o metionina (M), X3 es lisina (K) o arginina (R), X4 es la leucina (L), metionina (M), X5es triptófano (W), tirosina (Y), fenilalanina (F) o isoleucina (I), X6 es asparagina (N), ácido glutámico (E), alanina (A) o cisteína (C), X7 es cisteína (C), n y m son, independientemente, 0 ó 1, presentando dicho compuesto una capacidad de unión a un anticuerpo que es específico para un epítopo del péptido beta amiloide (Aß) que comprende la secuencia de aminoácidos HQKLVF y/o HQKLVFFAED...

  9. 9.-

    PROCEDIMIENTOs PARA PREVENIR Y TRATAR LA ENFERMEDAD DE ALZEHIMER (AD)

    (05/2010)

    Utilización de un compuesto, constituido por - un péptido de 5 a 15 aminoácidos que incluye una secuencia aminoácida, seleccionada de entre el grupo constituido por DKELRI, DWELRI, YAEFRG, EAEFRG, DYEFRG, DRELRI, GREFRN, EYEFRG, DWEFRDA, SWEFRT y DKELR, conteniendo dicho péptido un residuo adicional de cisteína en el extremo C y - un soporte proteico acoplado mediante dicho residuo de cisteína a dicho péptido, para la preparación de una vacuna destinada a la enfermedad de Alzheimer (AD)